Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G56010 225 / 7e-71 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT3G12977 205 / 9e-64 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G18400 170 / 8e-50 NAC ANAC058 NAC domain containing protein 58 (.1) AT4G28530 169 / 3e-49 NAC ANAC074 NAC domain containing protein 74 (.1.2) AT1G76420 168 / 8e-49 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G07680 166 / 3e-48 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G39610 164 / 5e-48 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT2G24430 165 / 7e-48 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT5G18270 165 / 1e-47 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT5G53950 163 / 2e-46 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042466 [exp] 522 / 0 AT1G56010 273 / 9e-90 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Lus10022915 [exp] 172 / 1e-50 AT4G28530 274 / 7e-91 NAC domain containing protein 74 (.1.2) Lus10013205 [exp] 172 / 2e-49 AT1G76420 270 / 4e-88 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10033905 [exp] 166 / 5e-48 AT4G28530 271 / 2e-89 NAC domain containing protein 74 (.1.2) Lus10005537 [exp] 164 / 1e-47 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10020165 [exp] 166 / 4e-47 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10041924 [exp] 159 / 8e-47 AT5G53950 281 / 9e-95 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10026966 [exp] 164 / 1e-46 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10021659 [exp] 160 / 6e-46 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G098200 [exp] 268 / 1e-87 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.007G065400 [exp] 263 / 7e-86 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.002G037100 [exp] 172 / 3e-51 AT4G28530 276 / 6e-92 NAC domain containing protein 74 (.1.2) Potri.005G225800 [exp] 171 / 1e-50 AT4G28530 270 / 1e-89 NAC domain containing protein 74 (.1.2) Potri.012G056300 [exp] 171 / 5e-50 AT3G18400 317 / 6e-108 NAC domain containing protein 58 (.1) Potri.015G046800 [exp] 170 / 1e-49 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1) Potri.006G277000 [exp] 167 / 2e-48 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.002G005800 [exp] 167 / 7e-48 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.018G003800 [exp] 166 / 8e-48 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.012G001400 [exp] 166 / 1e-47 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10026200 pacid=23156432 polypeptide=Lus10026200 locus=Lus10026200.g ID=Lus10026200.BGIv1.0 annot-version=v1.0 ATGTCTGTGAGCAAGATAAGGATGGTGGAGGCGAAGTTGGCGCCGGGGTTTAGGTTTCATCCAAGAGATGAAGAGCTTGTCTGTGATTACCTCTTCAACA AGATCACCTTCTCCCGCTCTCTCTTCTTCATCGAAGTTGACCTCAACAACTGCGAACCTTGGGATCTTCCTGAAACAACAAGGGTGGGAGGAAAAGAGTG GTACTTCTACAGCCGAAGGGACCGAAAGTATGCAACGGGGCTCCGAACCAACAGAGCCACCGCATCGGGGTATTGGAAGGCCACCGGAAAGGATCGGGCA GTGATACGAAATGAAGTATCAAGCAACAAACGAAGGCAACAACAACTAGTCGGGATGCGAAAGACCTTGGTGTTTTACCAAGGCCGAGCCCCTAAAGGCC ACACAACCGATTGGGGTATGCTAAAGGCCACAAAACCGATTGGGTTATGCACGAGTTCCGACTCGAAGGCCCGCTTGCTAGCCCTAGAACAACTGCTTCC TCTCATAATAAGAGTAGCTAAGGAGGACTGGGTGTTGTGTCGAGTGTTCTACAAAGACAAAGAAGTCATCAATTCGAAACAAAGCAAGATTGAAATTCTT CGGAACAACAACAACAACAATTATGAAGAAGAGGATGATGATTATGTGGAGAATGAATATAGCTCATCTTCCCACCTCCCCCCATTGACAGACTCTTCTT ACAACAACATCACTTGTCACCAACAACAACAACCCTTAGTACTTGCCAGTTGTTTGAATGATGATCAGTATGAGCAAGTGCCCTGCTTCTCCATTTTATC CCAAAACGTGTTATCTTCGTCTTCTGTGACCCCTCAGTTCAACTTCTCCCATCATCATGATGCTAACGACTACAACGTGATCACCACTGCAACAGCTGCT GTCACTGATGCTTCATTAACATTGCCTATCGATCATCATCATCATGTGATCAACAATGGTCATTTGGAGGATCATGACACTTTGAGTAATTGTGACAAGA AGGTCATGAAAGAAGTGTTGAATCATCTCACCAAGGTGGAAAGCACCAGTTATAATAACTACAATTACCAGCTTTATTCATCATCCTTGAGCTTGGTTGA AGGAAGCCCTGAGAGCTACCTCTCTGAGGTGGGCATCGCCAACATTTGGAATCGTTATTGA
AA sequence Show only first row Show all	>Lus10026200 pacid=23156432 polypeptide=Lus10026200 locus=Lus10026200.g ID=Lus10026200.BGIv1.0 annot-version=v1.0 MSVSKIRMVEAKLAPGFRFHPRDEELVCDYLFNKITFSRSLFFIEVDLNNCEPWDLPETTRVGGKEWYFYSRRDRKYATGLRTNRATASGYWKATGKDRA VIRNEVSSNKRRQQQLVGMRKTLVFYQGRAPKGHTTDWGMLKATKPIGLCTSSDSKARLLALEQLLPLIIRVAKEDWVLCRVFYKDKEVINSKQSKIEIL RNNNNNNYEEEDDDYVENEYSSSSHLPPLTDSSYNNITCHQQQQPLVLASCLNDDQYEQVPCFSILSQNVLSSSSVTPQFNFSHHHDANDYNVITTATAA VTDASLTLPIDHHHHVINNGHLEDHDTLSNCDKKVMKEVLNHLTKVESTSYNNYNYQLYSSSLSLVEGSPESYLSEVGIANIWNRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G56010	NAC	NAC1, ANAC021, ...	Arabidopsis NAC domain contain...		Lus10026200 [exp]	0	1
AT4G36810		GGPS1	geranylgeranyl pyrophosphate s...		Lus10009138 [exp]	2.0	0.9183
AT2G34930			disease resistance family prot...		Lus10006948 [exp]	2.4	0.9203
					Lus10022643 [exp]	4.5	0.8785
AT2G21100			Disease resistance-responsive ...		Lus10034479 [exp]	7.7	0.9178
AT5G47450		ATTIP2;3, DELTA...	DELTA-TONOPLAST INTRINSIC PROT...		Lus10007796 [exp]	8.2	0.9172
AT5G66600			Protein of unknown function, D...		Lus10022480 [exp]	8.8	0.8439
AT1G71380		ATCEL3 ,ATGH9B3	ARABIDOPSIS THALIANA GLYCOSYL ...		Lus10002930 [exp]	11.0	0.8526
AT1G52820			2-oxoglutarate (2OG) and Fe(II...		Lus10016659 [exp]	11.4	0.8887
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	12.8	0.8848
AT2G30210		LAC3	laccase 3 (.1)		Lus10042249 [exp]	13.9	0.8990

Compare expression of checked genes

Lus10026200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.