Lus10026210 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G73240 149 / 2e-43 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042457 266 / 8e-88 AT1G73240 486 / 6e-168 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G013300 206 / 4e-65 AT1G73240 464 / 1e-159 unknown protein
Potri.003G213050 179 / 4e-57 AT1G73240 276 / 4e-90 unknown protein
PFAM info
Representative CDS sequence
>Lus10026210 pacid=23156499 polypeptide=Lus10026210 locus=Lus10026210.g ID=Lus10026210.BGIv1.0 annot-version=v1.0
ATGAATGAACCATGTAGTTCACTCGAACTGACATATCCTGTGCTACATACAAAAAGGTTCATATTTGCCCCGCCAAAAGGATCAGCTGCTGCAGAAACAA
ATCCAACTGAGCCGCTTATTGCAGCCCTGGAAGAAACCGCCTCTGATTCTCTTCCACAGTATCTTGCGTATCTCGACCTTTGCATGGTATGTGAAAACAA
TGTTGATATTTGGAGGAGAGCTGCATTTTTTGAAGAAACTGGTGAGACATACAGAAAAGTAACAGCTGTGAGCTTGAAGCCATTGGAAGAGCTTGCTTCT
AAGTTATGTGAAGGTTTGGAAGGTAGTTCTGCTGACATGGAGTACCAACTATCCAAACAGCTACAATCAGCTACCGATCCACAACTGCCTTCAAGTAGTT
ATGAACCACTGAACAACTTTCAGGTAAATGGCAGTTAG
AA sequence
>Lus10026210 pacid=23156499 polypeptide=Lus10026210 locus=Lus10026210.g ID=Lus10026210.BGIv1.0 annot-version=v1.0
MNEPCSSLELTYPVLHTKRFIFAPPKGSAAAETNPTEPLIAALEETASDSLPQYLAYLDLCMVCENNVDIWRRAAFFEETGETYRKVTAVSLKPLEELAS
KLCEGLEGSSADMEYQLSKQLQSATDPQLPSSSYEPLNNFQVNGS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G73240 unknown protein Lus10026210 0 1
AT3G11250 Ribosomal protein L10 family p... Lus10009887 4.6 0.9058
AT3G13920 RH4, TIF4A1, EI... eukaryotic translation initiat... Lus10021583 4.9 0.8943
AT1G16870 mitochondrial 28S ribosomal pr... Lus10020429 5.7 0.8988
AT3G11250 Ribosomal protein L10 family p... Lus10014841 6.6 0.9049
AT3G09630 Ribosomal protein L4/L1 family... Lus10014014 11.7 0.8912
AT2G05920 Subtilase family protein (.1) Lus10033431 14.1 0.8792
AT3G03060 P-loop containing nucleoside t... Lus10031211 14.3 0.8929
AT1G73240 unknown protein Lus10026211 16.5 0.8621
AT3G23940 dehydratase family (.1.2) Lus10033370 17.5 0.8528
AT5G58420 Ribosomal protein S4 (RPS4A) f... Lus10004272 18.9 0.8822

Lus10026210 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.