Lus10026220 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44290 121 / 4e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G44300 121 / 5e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G55260 120 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT5G55490 112 / 3e-27 GEX1, ATGEX1 gamete expressed protein 1 (.1)
AT3G58550 96 / 8e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT2G48130 59 / 3e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G73890 59 / 3e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT1G03103 58 / 4e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT4G14815 55 / 4e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G22600 55 / 5e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042450 290 / 1e-93 AT5G55490 541 / 0.0 gamete expressed protein 1 (.1)
Lus10029726 241 / 8e-75 AT5G55490 572 / 0.0 gamete expressed protein 1 (.1)
Lus10002182 235 / 2e-72 AT5G55490 579 / 0.0 gamete expressed protein 1 (.1)
Lus10039900 230 / 1e-70 AT5G55490 575 / 0.0 gamete expressed protein 1 (.1)
Lus10042449 214 / 1e-68 AT1G55260 160 / 3e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10035975 110 / 1e-26 AT2G17270 398 / 7e-137 phosphate transporter 3;3 (.1)
Lus10033076 79 / 3e-17 AT2G44290 114 / 6e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10017749 79 / 4e-17 AT2G44290 115 / 3e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10021911 58 / 1e-09 AT1G05450 121 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G137100 189 / 4e-55 AT5G55490 579 / 0.0 gamete expressed protein 1 (.1)
Potri.003G217000 140 / 3e-40 AT1G55260 149 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.001G008500 138 / 9e-40 AT2G44290 155 / 6e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G232000 125 / 7e-35 AT2G44300 179 / 4e-57 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.006G195700 121 / 2e-33 AT2G44290 145 / 6e-44 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G085400 56 / 2e-09 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.008G155100 56 / 3e-09 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.003G172400 52 / 6e-08 AT1G27950 145 / 5e-44 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Potri.002G050300 52 / 7e-08 AT3G22600 117 / 3e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.001G056200 52 / 7e-08 AT1G27950 149 / 1e-45 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10026220 pacid=23156533 polypeptide=Lus10026220 locus=Lus10026220.g ID=Lus10026220.BGIv1.0 annot-version=v1.0
ATGGGGCTGGCTCCTTGCCTGACGTACGTGACCGGTGGATCCAAAGCTCCGACGCTGGATTGTTGCTCCGGTCTGAAACAGGTGATGGAGAAGAGCACCA
AGTGCCTTTGCTTGTTAATTAAAGACCGCGACGACCCCGATCTCGGCATCAAAGTCAACGTCTCCCTCGCCGCTAGCCTCCCCAACTCCTGCCACACTCC
GGCTAATGTCTCCGATTGCGTCAGTATTCTGCATCTAGCACCTAATTCGGCGGACGCCAAGAAGTTTGATGGACTGGATGACTTAATCTCCAAAGGAATC
AATGGAAACAGTACTACTACTGCAACTTCTGCAACTTCTGCCGGGAGCACCGGCGGGGGTGGGAGTGAACGCGGGAATGAGAAGAGCGGCGGAGAGGGAG
GGATGAAGGGAGGGAACTGGTGGCGGATGGTGGTGGTGGGGATATGGGGAGGTACATGCCTTCAGAAGGAAACGGAGAGACTGGTGGATGAACTGAAGAG
TTCAGCGCAATACACGAAGAGAGAGTTGGAGATTATAAAAGACACAACATTTACAGTGCTGCAGAACTCGAATCAGATACACGATTCTTTGAGTTCGGTG
TATCTCAAGGTTCAAGAAGTGGTTCGGACGGCTAAGGATGCAGAGAGTCAGATCGATTCCTTGTCAAAGAAGTCAGAAGCAGTTTTCCAAAAATCGGAGG
AAATCGTGGAGTCGCAAACACAACTTGAGGCAGGACAAGAGAGAATGAATGAGAATTTGAAAGCAGGGGTGACAATGTGTCATGATGCTTACAGCATCTT
GGGCGAGGAAGTTAGCAACGCGAGGAACGAGGCTGTCGAGACAAAGAAGCATATTGATCAAGTCGGAGAGTCAATGTCGTCCAGGTTTCAGAATCTGCAG
AGCAAAGCTGATGATATTGAAAATCTTGCTGGAAGTTCCTTGGGCAAGCAGCAAGAACTTCTAGATGTTCTACATTCCTAA
AA sequence
>Lus10026220 pacid=23156533 polypeptide=Lus10026220 locus=Lus10026220.g ID=Lus10026220.BGIv1.0 annot-version=v1.0
MGLAPCLTYVTGGSKAPTLDCCSGLKQVMEKSTKCLCLLIKDRDDPDLGIKVNVSLAASLPNSCHTPANVSDCVSILHLAPNSADAKKFDGLDDLISKGI
NGNSTTTATSATSAGSTGGGGSERGNEKSGGEGGMKGGNWWRMVVVGIWGGTCLQKETERLVDELKSSAQYTKRELEIIKDTTFTVLQNSNQIHDSLSSV
YLKVQEVVRTAKDAESQIDSLSKKSEAVFQKSEEIVESQTQLEAGQERMNENLKAGVTMCHDAYSILGEEVSNARNEAVETKKHIDQVGESMSSRFQNLQ
SKADDIENLAGSSLGKQQELLDVLHS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44300 Bifunctional inhibitor/lipid-t... Lus10026220 0 1
AT4G36960 RNA-binding (RRM/RBD/RNP motif... Lus10009360 6.6 0.7745
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Lus10031177 7.7 0.8091
AT5G64210 AOX2 alternative oxidase 2 (.1) Lus10005372 10.3 0.7912
AT3G20870 ZTP29 zinc transporter 29, ZIP metal... Lus10031268 11.1 0.7838
AT4G02050 STP7 sugar transporter protein 7 (.... Lus10036325 14.5 0.7424
AT5G58950 Protein kinase superfamily pro... Lus10015436 18.3 0.7252
AT3G25680 unknown protein Lus10021714 18.5 0.7602
AT4G21470 ATFMN/FHY riboflavin kinase/FMN hydrolas... Lus10028605 20.0 0.7490
AT1G36160 GSD1, PAS3, GK,... PASTICCINO 3, GLOSSYHEAD 1, GU... Lus10024747 21.2 0.7064
AT4G12590 Protein of unknown function DU... Lus10039028 21.7 0.7626

Lus10026220 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.