Lus10026232 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30380 90 / 2e-23 EXLB2 Barwin-related endoglucanase (.1)
AT2G18660 66 / 2e-14 AtPNP-A, PNP-A, EXLB3 plant natriuretic peptide A (.1)
AT1G62980 45 / 5e-06 ATHEXPALPHA1.25, ATEXP18, ATEXPA18 EXPANSIN 18, expansin A18 (.1)
AT4G01630 44 / 1e-05 ATEXP17, ATHEXPALPHA1.13, ATEXPA17 EXPANSIN 17, expansin A17 (.1)
AT3G29030 42 / 7e-05 ATEXP5, ATHEXPALPHA1.4, ATEXPA5 ARABIDOPSIS THALIANA EXPANSIN A5, ARABIDOPSIS THALIANA EXPANSIN 5, expansin A5 (.1)
AT2G20750 42 / 7e-05 ATHEXPBETA1.5, ATEXPB1 expansin B1 (.1)
AT5G56320 40 / 0.0002 ATHEXPALPHA1.5, ATEXP14, ATEXPA14 EXPANSIN 14, expansin A14 (.1)
AT3G15370 39 / 0.0007 ATHEXPALPHA1.24, ATEXP12, ATEXPA12 expansin 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042435 214 / 3e-72 AT4G30380 101 / 2e-28 Barwin-related endoglucanase (.1)
Lus10019978 84 / 4e-21 AT4G30380 162 / 8e-53 Barwin-related endoglucanase (.1)
Lus10026931 79 / 3e-18 AT4G30380 64 / 9e-13 Barwin-related endoglucanase (.1)
Lus10030078 69 / 8e-15 AT2G18660 84 / 3e-21 plant natriuretic peptide A (.1)
Lus10020130 67 / 7e-14 AT2G18660 70 / 2e-15 plant natriuretic peptide A (.1)
Lus10031759 64 / 3e-13 AT2G18660 107 / 1e-30 plant natriuretic peptide A (.1)
Lus10026930 64 / 1e-12 AT2G18660 69 / 6e-15 plant natriuretic peptide A (.1)
Lus10020131 60 / 1e-11 AT2G18660 59 / 2e-11 plant natriuretic peptide A (.1)
Lus10013118 60 / 1e-11 AT4G30380 67 / 5e-15 Barwin-related endoglucanase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.003G218300 115 / 2e-33 AT4G30380 86 / 2e-22 Barwin-related endoglucanase (.1)
Potri.018G098200 113 / 2e-32 AT4G30380 122 / 5e-37 Barwin-related endoglucanase (.1)
Potri.006G176300 90 / 2e-23 AT4G30380 165 / 6e-54 Barwin-related endoglucanase (.1)
Potri.018G101600 87 / 3e-22 AT2G18660 113 / 3e-33 plant natriuretic peptide A (.1)
Potri.006G179300 83 / 9e-21 AT2G18660 116 / 1e-34 plant natriuretic peptide A (.1)
Potri.006G252200 67 / 9e-15 AT2G18660 91 / 2e-24 plant natriuretic peptide A (.1)
Potri.018G029100 66 / 2e-14 AT2G18660 94 / 2e-25 plant natriuretic peptide A (.1)
Potri.006G249500 61 / 2e-12 AT4G30380 61 / 1e-12 Barwin-related endoglucanase (.1)
Potri.018G031901 60 / 9e-12 AT4G30380 57 / 3e-11 Barwin-related endoglucanase (.1)
Potri.006G155000 52 / 8e-09 AT2G18660 59 / 1e-11 plant natriuretic peptide A (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0199 DPBB PF03330 DPBB_1 Lytic transglycolase
Representative CDS sequence
>Lus10026232 pacid=23156591 polypeptide=Lus10026232 locus=Lus10026232.g ID=Lus10026232.BGIv1.0 annot-version=v1.0
ATGGCACACCGATGGCAGCCGTCGGCCACCGNNTTCGCCCACCGTTTTAGTGGTGGTCGTGATTTCAAATTATCAAAAGAAGGTAGAGATTTCGGAGGAA
CAACCGATGATTTGAGAATTTTAATCAAAATTGTCCTTCTATTTCTGTGTGCACCATCGGCTTGCTACGGGTACGACGCGCAGGACGGGATGACGGCAGC
AGCAAGTGAAACGCACCTTTGGAAAGGCGGACGTGCTTGCGGGAAGCGTTATAAAGTGAAATGCTTAAGCGGGACCAACCAAGGAGTTGCGGTGCCTTGC
AAGAAAGGCAAGACTGTTACGGTGAAGATCATCGACCTATGTCCTGCCGTCGGCTGCAAGGCTACCATTGACTTGTCTCAGAAAGCCTTTGCCCACATCG
CTGACCCTGACGAGGGAATCATCAACATCTCCTACCAAGAGTACGTCTCGAGCTCTCATAATAACTACTACAAAAAGAATGTAGTTTTAGAGGTGGTAAT
TAATTATGTGACTGTTTAA
AA sequence
>Lus10026232 pacid=23156591 polypeptide=Lus10026232 locus=Lus10026232.g ID=Lus10026232.BGIv1.0 annot-version=v1.0
MAHRWQPSATXFAHRFSGGRDFKLSKEGRDFGGTTDDLRILIKIVLLFLCAPSACYGYDAQDGMTAAASETHLWKGGRACGKRYKVKCLSGTNQGVAVPC
KKGKTVTVKIIDLCPAVGCKATIDLSQKAFAHIADPDEGIINISYQEYVSSSHNNYYKKNVVLEVVINYVTV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 0 1
AT1G21430 YUC11 Flavin-binding monooxygenase f... Lus10000677 5.1 1.0000
AT3G51590 LTP12 lipid transfer protein 12 (.1) Lus10009630 5.3 1.0000
Lus10011605 5.9 1.0000
Lus10025268 7.0 1.0000
AT2G15220 Plant basic secretory protein ... Lus10001608 7.2 1.0000
AT4G35580 NAC NTL9, CBNAC NAC transcription factor-like ... Lus10005144 8.8 1.0000
AT2G24960 unknown protein Lus10042715 12.0 0.9619
AT4G33860 Glycosyl hydrolase family 10 p... Lus10033787 12.4 0.9530
Lus10024141 12.5 1.0000
AT4G32690 ATGLB3, GLB3 ARABIDOPSIS HEMOGLOBIN 3, hemo... Lus10007678 13.0 1.0000

Lus10026232 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.