Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G014101 [exp] 36 / 5e-05 AT5G10745 36 / 5e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026240 pacid=23156501 polypeptide=Lus10026240 locus=Lus10026240.g ID=Lus10026240.BGIv1.0 annot-version=v1.0 ATGGCTAAGGAATCAGCGCCGCGCTCGTTATCTCTCGATTTGGTGCCTTTCGCTGTTGTCGTGCTGCTAGCTGCTCATGTTATTGCTTTGGTTTACTGGA TGTACAGATTAGCCACCGATAAGCAGCCACCGAGGAGGAAGGAACATTGA
AA sequence Show only first row Show all	>Lus10026240 pacid=23156501 polypeptide=Lus10026240 locus=Lus10026240.g ID=Lus10026240.BGIv1.0 annot-version=v1.0 MAKESAPRSLSLDLVPFAVVVLLAAHVIALVYWMYRLATDKQPPRRKEH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10745			unknown protein		Lus10026240 [exp]	0	1
					Lus10015674 [exp]	6.3	0.8305
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Lus10039931 [exp]	9.6	0.8662
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10002901 [exp]	9.9	0.8686
AT2G12646			PLATZ transcription factor fam...		Lus10008814 [exp]	14.5	0.8687
AT4G17190		FPS2	farnesyl diphosphate synthase ...		Lus10022545 [exp]	14.5	0.8607
AT3G57670	C2H2ZnF	WIP2, NTT	WIP domain protein 2, NO TRANS...		Lus10039613 [exp]	15.6	0.8203
AT5G63220			unknown protein		Lus10036505 [exp]	16.2	0.8578
AT1G08220			unknown protein		Lus10005355 [exp]	22.9	0.8422
AT4G33250		ATTIF3K1, EIF3K	eukaryotic translation initiat...		Lus10027668 [exp]	23.2	0.8656
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10001732 [exp]	26.2	0.8517

Compare expression of checked genes

Lus10026240 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.