Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G31820 75 / 4e-16 MAB4, ENP, NPY1 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) AT1G67900 67 / 2e-13 Phototropic-responsive NPH3 family protein (.1.2.3) AT2G14820 62 / 1e-11 MEL3, NPY2 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) AT5G64330 61 / 6e-11 JK218, RPT3, NPH3 ROOT PHOTOTROPISM 3, NON-PHOTOTROPIC HYPOCOTYL 3, Phototropic-responsive NPH3 family protein (.1.2) AT5G03250 60 / 9e-11 Phototropic-responsive NPH3 family protein (.1) AT1G30440 59 / 1e-10 Phototropic-responsive NPH3 family protein (.1) AT5G66560 59 / 2e-10 Phototropic-responsive NPH3 family protein (.1) AT4G37590 58 / 4e-10 MEL1, NPY5 NAKED PINS IN YUC MUTANTS 5, MAB4/ENP/NPY1-LIKE 1, Phototropic-responsive NPH3 family protein (.1) AT5G67440 58 / 4e-10 MEL2, NPY3 NAKED PINS IN YUC MUTANTS 3, MAB4/ENP/NPY1-LIKE 2, Phototropic-responsive NPH3 family protein (.1.2) AT2G23050 57 / 1e-09 MEL4, NPY4 NAKED PINS IN YUC MUTANTS 4, MAB4/ENP/NPY1-LIKE 4, Phototropic-responsive NPH3 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026255 [exp] 221 / 4e-67 AT4G31820 557 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Lus10042414 [exp] 211 / 1e-65 AT4G31820 612 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Lus10026702 [exp] 65 / 2e-13 AT1G67900 207 / 5e-64 Phototropic-responsive NPH3 family protein (.1.2.3) Lus10033796 [exp] 65 / 1e-12 AT2G14820 735 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10000443 [exp] 65 / 2e-12 AT1G67900 797 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Lus10025192 [exp] 64 / 3e-12 AT2G14820 248 / 2e-77 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10013799 [exp] 63 / 6e-12 AT5G03250 672 / 0.0 Phototropic-responsive NPH3 family protein (.1) Lus10014632 [exp] 63 / 7e-12 AT2G14820 741 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Lus10026511 [exp] 63 / 1e-11 AT5G03250 665 / 0.0 Phototropic-responsive NPH3 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G018600 [exp] 120 / 4e-32 AT4G31820 630 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Potri.006G264300 [exp] 108 / 8e-28 AT4G31820 623 / 0.0 NAKED PINS IN YUC MUTANTS 1, MACCHI-BOU 4, ENHANCER OF PINOID, Phototropic-responsive NPH3 family protein (.1) Potri.001G295600 [exp] 65 / 2e-12 AT2G14820 771 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.008G186100 [exp] 64 / 3e-12 AT1G67900 833 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Potri.005G146400 [exp] 64 / 3e-12 AT2G14820 671 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.009G089500 [exp] 63 / 7e-12 AT2G14820 732 / 0.0 NAKED PINS IN YUC MUTANTS 2, MAB4/ENP/NPY1-LIKE 3, Phototropic-responsive NPH3 family protein (.1) Potri.010G046800 [exp] 62 / 1e-11 AT1G67900 861 / 0.0 Phototropic-responsive NPH3 family protein (.1.2.3) Potri.008G038600 [exp] 61 / 6e-11 AT5G03250 723 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.016G090400 [exp] 60 / 1e-10 AT5G03250 768 / 0.0 Phototropic-responsive NPH3 family protein (.1) Potri.007G033900 [exp] 59 / 2e-10 AT5G66560 789 / 0.0 Phototropic-responsive NPH3 family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026256 pacid=23156415 polypeptide=Lus10026256 locus=Lus10026256.g ID=Lus10026256.BGIv1.0 annot-version=v1.0 ATGTGCAGCATGTTGGATGTTAAGAAGCTGACAATGAATGCTTCAATGCACGCAGCACAAAATGAGAGTCTCCCGCTTCGTTTGGTTGTACAAGTTCTCT TCTTTGAGCAGGTCAGAGCAGCAGCAGCAGCAGCTAATGGTCAAAGCCTCAACCACAACCTGAATTACACTTCGAATGCGACGAAAAACACAGAGGAAGG TTGCGAAGTCCTGGAGAAGCAAATGAGCGTGAAATTGAAGGTAGCAACTGTTGAGGCTGAGGAGGAGGAAGAGGAGGAGCAGAGGAATATGAGGCTGATG AAGAAAAACAGCAGCAAGAATAGCAAAAGTGGATTGCAGTTGCTACCATCTCGTTCAAGGAGAATATTTGACAAGTTGTGGGGTGTTGGGAGGGGAGGGC ATGTAGTAGAGAGCAAGAGCTCTGAGACATCTGGCAGCTCAGAGAGCCCACCTTCAATGGCTCCTGGAGATGCCAAGTCTTCTGGTTCATCTTCAAGGCA CAGGAGACACTCCATCTCCTGA
AA sequence Show only first row Show all	>Lus10026256 pacid=23156415 polypeptide=Lus10026256 locus=Lus10026256.g ID=Lus10026256.BGIv1.0 annot-version=v1.0 MCSMLDVKKLTMNASMHAAQNESLPLRLVVQVLFFEQVRAAAAAANGQSLNHNLNYTSNATKNTEEGCEVLEKQMSVKLKVATVEAEEEEEEEQRNMRLM KKNSSKNSKSGLQLLPSRSRRIFDKLWGVGRGGHVVESKSSETSGSSESPPSMAPGDAKSSGSSSRHRRHSIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G31820		MAB4, ENP, NPY1	NAKED PINS IN YUC MUTANTS 1, M...		Lus10026256 [exp]	0	1
AT4G31820		MAB4, ENP, NPY1	NAKED PINS IN YUC MUTANTS 1, M...		Lus10026255 [exp]	1.0	0.9811
AT3G14690		CYP72A15	"cytochrome P450, family 72, s...		Lus10042487 [exp]	5.5	0.9185
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10016471 [exp]	6.2	0.9328
AT4G02860			Phenazine biosynthesis PhzC/Ph...		Lus10003725 [exp]	6.7	0.8995
AT5G03380			Heavy metal transport/detoxifi...		Lus10021516 [exp]	7.0	0.8971
AT2G28305		ATLOG1	LONELY GUY 1, Putative lysine ...		Lus10019712 [exp]	7.7	0.8864
AT5G59590		UGT76E2	UDP-glucosyl transferase 76E2 ...		Lus10016460 [exp]	10.6	0.9016
AT1G22100			Inositol-pentakisphosphate 2-k...		Lus10010640 [exp]	13.4	0.8905
AT5G25220	HD	KNAT3	KNOTTED1-like homeobox gene 3 ...		Lus10003183 [exp]	18.5	0.8954
AT2G04240		XERICO	RING/U-box superfamily protein...		Lus10034407 [exp]	22.5	0.8909

Compare expression of checked genes

Lus10026256 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.