Lus10026293 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026293 pacid=23156525 polypeptide=Lus10026293 locus=Lus10026293.g ID=Lus10026293.BGIv1.0 annot-version=v1.0
ATGGATAATGAAGAAGAAGAAGATGAACTGGCAGAGACACTAAGAGATACCAGCAAAGCAGTTGAAGAAAATGTCGCTGAAGAGAATTTGATAAATGGAA
ATGGAAAGGATTTTGTTATCATCGAAAGTTACCCTGAACAAGCTCTCAGTGGAGGATGTTTTCATCAGCAATATCGCTATTGTTGTCCGAGCATTTAA
AA sequence
>Lus10026293 pacid=23156525 polypeptide=Lus10026293 locus=Lus10026293.g ID=Lus10026293.BGIv1.0 annot-version=v1.0
MDNEEEEDELAETLRDTSKAVEENVAEENLINGNGKDFVIIESYPEQALSGGCFHQQYRYCCPSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026293 0 1
AT3G05600 alpha/beta-Hydrolases superfam... Lus10029878 1.4 0.9966
AT5G53950 NAC ATCUC2, CUC2, A... CUP-SHAPED COTYLEDON 2, Arabid... Lus10005537 1.4 0.9973
AT1G65870 Disease resistance-responsive ... Lus10016231 3.7 0.9949
AT2G17950 HD WUS1, PGA6, WUS WUSCHEL 1, WUSCHEL, Homeodomai... Lus10041909 3.9 0.9956
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10013960 3.9 0.9966
AT5G01150 Protein of unknown function (D... Lus10003168 4.0 0.9962
AT2G35160 SGD9, SUVH5 SET DOMAIN-CONTAINING PROTEIN ... Lus10043211 4.2 0.9954
AT2G28790 Pathogenesis-related thaumatin... Lus10005453 6.2 0.9891
AT5G45980 HD WOX9B, STPL, WO... WUSCHEL related homeobox 9B, S... Lus10005282 6.6 0.9904
AT4G37370 CYP81D8 "cytochrome P450, family 81, s... Lus10018717 6.9 0.9903

Lus10026293 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.