Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34810 124 / 2e-38 SAUR-like auxin-responsive protein family (.1) AT4G34800 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT2G21210 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT4G38840 105 / 4e-31 SAUR-like auxin-responsive protein family (.1) AT4G34790 101 / 3e-29 SAUR-like auxin-responsive protein family (.1) AT5G18030 98 / 5e-28 SAUR-like auxin-responsive protein family (.1) AT4G34770 98 / 5e-28 SAUR-like auxin-responsive protein family (.1) AT5G18020 97 / 1e-27 SAUR-like auxin-responsive protein family (.1) AT5G18080 96 / 2e-27 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18050 95 / 7e-27 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042378 [exp] 200 / 3e-68 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 164 / 8e-54 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 163 / 1e-53 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10042377 [exp] 157 / 1e-51 AT4G34810 120 / 6e-37 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 106 / 3e-31 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008999 [exp] 102 / 7e-30 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 101 / 2e-29 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 100 / 1e-28 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 99 / 2e-28 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G127500 [exp] 120 / 8e-37 AT2G21210 128 / 5e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G166100 [exp] 115 / 4e-35 AT2G21210 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 110 / 4e-33 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 109 / 8e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 108 / 1e-31 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 107 / 1e-31 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 105 / 7e-31 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G166300 [exp] 105 / 1e-30 AT5G18020 113 / 6e-34 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 104 / 2e-30 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 102 / 5e-30 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10026294 pacid=23156390 polypeptide=Lus10026294 locus=Lus10026294.g ID=Lus10026294.BGIv1.0 annot-version=v1.0 ATGGGTATCGGTCGGTTGGCTTCAGCAGTGCTTACTGTTAGGCAAAAGATCAAGGGGAAGTCTCTGATTCATAATAGCAGTAGTGATCAGTGTGTGCCAA AGGGGCATGTTGCAGTTTACGTTGGGGAAGAGATGCAAATGATGATGAAGAGATTTGTGGTTCCAATTTCTTGTTTGAGCAATCCTTCATTCAAGGACTT GCTTCGGAGAGCCGAGGAAGAGTTCGGGTTTGATCATCCCATGGGTGGACTCACTATCCCTTGTAGAGAGGATGCCTTCATTGATCTTATTGCCTCTCAC TTATAG
AA sequence Show only first row Show all	>Lus10026294 pacid=23156390 polypeptide=Lus10026294 locus=Lus10026294.g ID=Lus10026294.BGIv1.0 annot-version=v1.0 MGIGRLASAVLTVRQKIKGKSLIHNSSSDQCVPKGHVAVYVGEEMQMMMKRFVVPISCLSNPSFKDLLRRAEEEFGFDHPMGGLTIPCREDAFIDLIASH L

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34810			SAUR-like auxin-responsive pro...		Lus10026294 [exp]	0	1
AT3G26700			Protein kinase superfamily pro...		Lus10041509 [exp]	2.0	0.9237
AT1G75240	ZF_HD	ATHB33, ZHD5	zinc-finger homeodomain 5, hom...		Lus10031315 [exp]	2.4	0.9508
AT5G51520			Plant invertase/pectin methyle...		Lus10031712 [exp]	4.0	0.9448
					Lus10031884 [exp]	6.9	0.9196
AT3G28040			Leucine-rich receptor-like pro...		Lus10035687 [exp]	7.5	0.9239
AT1G20190		ATHEXPALPHA1.14...	EXPANSIN 11, expansin 11 (.1)		Lus10021845 [exp]	13.2	0.9201
					Lus10025731 [exp]	16.7	0.9031
AT5G14020			Endosomal targeting BRO1-like ...		Lus10012563 [exp]	17.0	0.9083
AT1G05010		ACO4, EAT1, EFE	ethylene forming enzyme, ethyl...		Lus10015153 [exp]	17.3	0.9073
AT4G23820			Pectin lyase-like superfamily ...		Lus10003890 [exp]	17.9	0.9095

Compare expression of checked genes

Lus10026294 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.