Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38860 133 / 3e-42 SAUR-like auxin-responsive protein family (.1) AT4G34760 132 / 9e-42 SAUR-like auxin-responsive protein family (.1) AT2G21220 128 / 4e-40 SAUR-like auxin-responsive protein family (.1) AT1G75580 125 / 5e-39 SAUR-like auxin-responsive protein family (.1) AT1G19830 122 / 1e-37 SAUR-like auxin-responsive protein family (.1) AT2G16580 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) AT4G36110 114 / 9e-35 SAUR-like auxin-responsive protein family (.1) AT2G18010 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT5G66260 103 / 2e-30 SAUR-like auxin-responsive protein family (.1) AT2G21210 97 / 7e-28 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012189 [exp] 134 / 3e-42 AT4G34760 169 / 3e-56 SAUR-like auxin-responsive protein family (.1) Lus10007553 [exp] 125 / 6e-39 AT4G34760 168 / 9e-56 SAUR-like auxin-responsive protein family (.1) Lus10034511 [exp] 123 / 5e-38 AT1G75580 161 / 9e-53 SAUR-like auxin-responsive protein family (.1) Lus10012432 [exp] 121 / 4e-37 AT1G75580 164 / 9e-54 SAUR-like auxin-responsive protein family (.1) Lus10033159 [exp] 121 / 4e-37 AT1G75580 160 / 1e-52 SAUR-like auxin-responsive protein family (.1) Lus10024326 [exp] 119 / 4e-36 AT1G75580 166 / 2e-54 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 112 / 9e-34 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10041921 [exp] 110 / 1e-32 AT4G34760 144 / 7e-46 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 99 / 2e-28 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G164400 [exp] 139 / 1e-44 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.009G126000 [exp] 139 / 3e-44 AT4G34760 179 / 4e-60 SAUR-like auxin-responsive protein family (.1) Potri.007G012800 [exp] 125 / 9e-39 AT4G34760 164 / 3e-54 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 123 / 4e-38 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 122 / 1e-37 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 102 / 1e-29 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 98 / 4e-28 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G127600 [exp] 94 / 3e-26 AT5G18080 116 / 7e-35 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127700 [exp] 93 / 3e-26 AT5G18080 114 / 1e-34 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 93 / 4e-26 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10026296 pacid=23156495 polypeptide=Lus10026296 locus=Lus10026296.g ID=Lus10026296.BGIv1.0 annot-version=v1.0 ATGTTGAAGCAGATACTGAAGCGATGCTCAAGCTTGGGGAAGAAACATGGCGGAAGTCAAGATCAGACGTGGTATGATGTACCAAGAGGACACTTTGCAG TTTACGTTGGGGAGAAGAGAAGTAGGTACATCGTCCCAATCACATTCCTCGCTCACCCTCAGTTCCAATGCCTCCTCCGAAGCGCTGAAGAAGAGTTCGG GTTCGATCACTGCATGGGCGGACTCACCCTCCCTTGTGAAGAAGTTGTCTTTTGCTCCCTCGCTTCATCAATGCTTACTAGGTGA
AA sequence Show only first row Show all	>Lus10026296 pacid=23156495 polypeptide=Lus10026296 locus=Lus10026296.g ID=Lus10026296.BGIv1.0 annot-version=v1.0 MLKQILKRCSSLGKKHGGSQDQTWYDVPRGHFAVYVGEKRSRYIVPITFLAHPQFQCLLRSAEEEFGFDHCMGGLTLPCEEVVFCSLASSMLTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34760			SAUR-like auxin-responsive pro...		Lus10026296 [exp]	0	1
AT2G37010		ATNAP12	non-intrinsic ABC protein 12 (...		Lus10023199 [exp]	4.2	0.8674
AT4G37330		CYP81D4	"cytochrome P450, family 81, s...		Lus10024817 [exp]	6.9	0.8501
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10012854 [exp]	8.5	0.8501
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10013728 [exp]	9.8	0.8501
					Lus10026928 [exp]	11.0	0.8501
AT2G46150			Late embryogenesis abundant (L...		Lus10027177 [exp]	12.0	0.8501
AT2G19800		MIOX2	myo-inositol oxygenase 2 (.1)		Lus10006198 [exp]	13.4	0.7423
AT5G10990			SAUR-like auxin-responsive pro...		Lus10042374 [exp]	13.7	0.6909
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10006360 [exp]	14.7	0.8309
					Lus10031895 [exp]	16.6	0.7766

Compare expression of checked genes

Lus10026296 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.