Lus10026297 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10990 102 / 2e-28 SAUR-like auxin-responsive protein family (.1)
AT1G19840 101 / 7e-28 SAUR-like auxin-responsive protein family (.1)
AT1G75590 100 / 2e-27 SAUR-like auxin-responsive protein family (.1)
AT4G34750 96 / 9e-26 SAUR-like auxin-responsive protein family (.1.2)
AT2G24400 70 / 2e-15 SAUR-like auxin-responsive protein family (.1)
AT1G76190 62 / 6e-13 SAUR-like auxin-responsive protein family (.1)
AT4G31320 62 / 1e-12 SAUR-like auxin-responsive protein family (.1)
AT4G34760 58 / 2e-11 SAUR-like auxin-responsive protein family (.1)
AT3G43120 58 / 4e-11 SAUR-like auxin-responsive protein family (.1)
AT1G56150 57 / 4e-11 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042374 198 / 3e-66 AT5G10990 125 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Lus10034507 115 / 3e-33 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012190 113 / 2e-32 AT4G34750 147 / 4e-46 SAUR-like auxin-responsive protein family (.1.2)
Lus10033161 110 / 1e-31 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1)
Lus10012426 106 / 5e-30 AT1G75590 181 / 2e-59 SAUR-like auxin-responsive protein family (.1)
Lus10007552 79 / 1e-19 AT1G75590 70 / 3e-16 SAUR-like auxin-responsive protein family (.1)
Lus10024322 76 / 3e-18 AT1G75590 152 / 3e-48 SAUR-like auxin-responsive protein family (.1)
Lus10026977 65 / 1e-13 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1)
Lus10034570 58 / 2e-11 AT1G76190 122 / 2e-37 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G164300 127 / 2e-38 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
Potri.009G125900 124 / 4e-37 AT5G10990 157 / 5e-50 SAUR-like auxin-responsive protein family (.1)
Potri.005G237000 110 / 1e-31 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1)
Potri.002G024500 107 / 2e-30 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 69 / 3e-15 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.018G132400 64 / 2e-13 AT3G43120 64 / 2e-13 SAUR-like auxin-responsive protein family (.1)
Potri.006G070600 61 / 4e-12 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 59 / 5e-12 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 59 / 7e-12 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.010G253800 60 / 9e-12 AT2G24400 142 / 4e-43 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10026297 pacid=23156564 polypeptide=Lus10026297 locus=Lus10026297.g ID=Lus10026297.BGIv1.0 annot-version=v1.0
ATGTCGAAGTTGAACAAAATCCGCCACATCGTCAGAATCCAGCAGATGCTTAAGCACTGGCGCCACAAAGCCAGAGCCAATAATAAGGCCACCTTATCGT
CCTCCTCCTCCTCCGATTCCTCATCATCATCATCACCCGAAGTCCCCGCCGGACACGTGGCGGTCCACGTCGGAGCGAGCGGCCAGAGGTTCGTCGTCCG
AGCCAGGTACCTCAACCATCCGATTTTCCAGAGCATTCTCGCGCGGGCAGAGGAAGAGTACGGATTCAAGAACGACGGGCCGTTGCGGATCCCTTGCGAG
GAGTGGGAGTTCGAGGAGATTCTCCGATTCGTGTCGAGATCGGATTCTAATAAGTTTGTGAATAATAACTATAATAATAGTCGATGCTCTTATTCTTGTA
ATCATTCGGAGCTAGTCGGCCCTCCTTCCGGGAGGCCTTTACTCCGTGGTTGA
AA sequence
>Lus10026297 pacid=23156564 polypeptide=Lus10026297 locus=Lus10026297.g ID=Lus10026297.BGIv1.0 annot-version=v1.0
MSKLNKIRHIVRIQQMLKHWRHKARANNKATLSSSSSSDSSSSSSPEVPAGHVAVHVGASGQRFVVRARYLNHPIFQSILARAEEEYGFKNDGPLRIPCE
EWEFEEILRFVSRSDSNKFVNNNYNNSRCSYSCNHSELVGPPSGRPLLRG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G10990 SAUR-like auxin-responsive pro... Lus10026297 0 1
AT3G60380 unknown protein Lus10028193 3.6 0.7189
AT5G20900 ZIM TIFY3B, JAZ12 jasmonate-zim-domain protein 1... Lus10011929 6.5 0.6629
AT1G63250 DEA(D/H)-box RNA helicase fami... Lus10019121 13.3 0.6089
AT5G67320 HOS15 high expression of osmotically... Lus10024972 21.1 0.6587
Lus10027487 25.9 0.5950
AT1G06210 ENTH/VHS/GAT family protein (.... Lus10022922 37.2 0.6449
AT2G02370 SNARE associated Golgi protein... Lus10012163 40.6 0.5714
Lus10015452 53.1 0.5675
AT5G64610 HAM1 histone acetyltransferase of t... Lus10012707 53.7 0.5588
AT5G02220 unknown protein Lus10001570 59.0 0.5586

Lus10026297 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.