Lus10026307 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026307 pacid=23156426 polypeptide=Lus10026307 locus=Lus10026307.g ID=Lus10026307.BGIv1.0 annot-version=v1.0
ATGCTGAAGCTGGTAGGCGATAGAAAGTGGGCCGGAAAGTGGAAATACATGGGCTACGGTCAACCATTGTCTGGGCCGAGAAGTGGAAATCTATTGCCCA
TGGGTTCAGGATCTGAGCTCTTGAAATGGGATACGCACTCTTACACCGTCGACTACAAAGTTTCCATGGCTGGGGTTCCTGGGTTAAGCCATGATGTGTT
GATATTGATGATGTATGAACAAGCAGACCCTTAA
AA sequence
>Lus10026307 pacid=23156426 polypeptide=Lus10026307 locus=Lus10026307.g ID=Lus10026307.BGIv1.0 annot-version=v1.0
MLKLVGDRKWAGKWKYMGYGQPLSGPRSGNLLPMGSGSELLKWDTHSYTVDYKVSMAGVPGLSHDVLILMMYEQADP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026307 0 1
AT5G14850 Alg9-like mannosyltransferase ... Lus10034759 10.7 0.7297
AT2G24960 unknown protein Lus10026250 10.8 0.7737
AT3G23910 unknown protein Lus10016653 16.0 0.6591
AT1G04945 HIT-type Zinc finger family pr... Lus10008703 16.2 0.7143
Lus10033536 31.1 0.6891
AT4G31580 SRZ22, RSZP22, ... RS-containing zinc finger prot... Lus10020123 36.3 0.7031
AT2G21710 EMB2219 embryo defective 2219, Mitocho... Lus10026342 43.2 0.6820
AT2G19560 ESSP1, AtTHP1, ... ectopic expression of seed sto... Lus10032680 47.8 0.6802
Lus10024697 54.1 0.6946
AT5G17440 LUC7 related protein (.1) Lus10026846 61.0 0.6932

Lus10026307 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.