Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042354 [exp] 45 / 2e-07 AT2G41905 62 / 2e-14 unknown protein Lus10040498 [exp] 40 / 1e-05 AT2G41905 64 / 1e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G052001 [exp] 37 / 0.0002 AT3G57690 / ARABINOGALACTAN-PROTEIN 23, arabinogalactan protein 23 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026313 pacid=23156487 polypeptide=Lus10026313 locus=Lus10026313.g ID=Lus10026313.BGIv1.0 annot-version=v1.0 ATGAACATGAAGAAGATCTCCTGCGCCGTCATCTTCGCCGCCGCCTCCATCAGCGCCGTCTTGGCCGCTGAAGAAGCTGCATTGCTCACTCCTTCCGCAA GCCCCGCCGCTGCCGCCGGCGCCCCTATGGCCGCCGGAGGTCCTGCCGCTGCGGGAGGGCCTGCGGGTGGCCCCACCAGTGATGCCAGCTCTGCATTGCC TGCATTTGGCACTTTGGTTGGAGCTTCCCTCGTTTCTGTCTTTGGTTACTATTTCCAGTGA
AA sequence Show only first row Show all	>Lus10026313 pacid=23156487 polypeptide=Lus10026313 locus=Lus10026313.g ID=Lus10026313.BGIv1.0 annot-version=v1.0 MNMKKISCAVIFAAASISAVLAAEEAALLTPSASPAAAAGAPMAAGGPAAAGGPAGGPTSDASSALPAFGTLVGASLVSVFGYYFQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G41905			unknown protein		Lus10026313 [exp]	0	1
AT5G07720			Galactosyl transferase GMA12/M...		Lus10000563 [exp]	2.6	0.8524
AT1G72430			SAUR-like auxin-responsive pro...		Lus10037443 [exp]	3.9	0.7857
AT4G29240			Leucine-rich repeat (LRR) fami...		Lus10012929 [exp]	5.5	0.8210
AT5G05480			Peptide-N4-(N-acetyl-beta-gluc...		Lus10017437 [exp]	6.5	0.8122
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041870 [exp]	10.2	0.8221
AT1G69430			unknown protein		Lus10036796 [exp]	10.4	0.8280
AT3G07480			2Fe-2S ferredoxin-like superfa...		Lus10009565 [exp]	14.4	0.8218
AT3G16240		DELTA-TIP1, ATT...	delta tonoplast integral prote...		Lus10038293 [exp]	17.7	0.7671
AT1G12500			Nucleotide-sugar transporter f...		Lus10007029 [exp]	20.3	0.8169
AT4G18030			S-adenosyl-L-methionine-depend...		Lus10003014 [exp]	22.6	0.8037

Compare expression of checked genes

Lus10026313 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.