Lus10026314 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs

No hit found

Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026314 pacid=23156397 polypeptide=Lus10026314 locus=Lus10026314.g ID=Lus10026314.BGIv1.0 annot-version=v1.0
ATGGCCCAGTCAAGCTTCTCTAAGGTAGCTACCCTCTCCGCGGTTGTCCTCGTCGCTTCCATGGCCGCCATGGTATCCGCTCAGGATATGATGGCCCCTG
CTCCCGCCCCGGCGAGCATGGCCGGCGCTGGCTTCTCCGTTCCCGTTTCCGGCGCTGTTGTAGCTGTCTCCCTTGTCGCTTCCCTTATGGGTTTCTTGAA
GATGTAG
AA sequence
>Lus10026314 pacid=23156397 polypeptide=Lus10026314 locus=Lus10026314.g ID=Lus10026314.BGIv1.0 annot-version=v1.0
MAQSSFSKVATLSAVVLVASMAAMVSAQDMMAPAPAPASMAGAGFSVPVSGAVVAVSLVASLMGFLKM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026314 0 1
Lus10042355 1.0 0.9500
AT1G12310 Calcium-binding EF-hand family... Lus10004332 1.4 0.9182
AT5G40150 Peroxidase superfamily protein... Lus10039471 3.5 0.8804
AT3G07470 Protein of unknown function, D... Lus10029538 3.9 0.8751
AT1G67570 Protein of unknown function (D... Lus10043011 4.2 0.8698
AT1G05010 ACO4, EAT1, EFE ethylene forming enzyme, ethyl... Lus10029992 4.5 0.8595
AT4G33640 unknown protein Lus10020463 5.5 0.8484
AT1G64980 Nucleotide-diphospho-sugar tra... Lus10005005 5.7 0.8561
AT5G01710 methyltransferases (.1) Lus10001267 7.5 0.8491
AT5G40140 RING/U-box superfamily protein... Lus10039447 7.7 0.8102

Lus10026314 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.