Lus10026316 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G17380 297 / 7e-105 AP19 associated protein 19 (.1)
AT4G35410 290 / 3e-102 Clathrin adaptor complex small chain family protein (.1.2)
AT1G47830 170 / 7e-55 SNARE-like superfamily protein (.1)
AT2G19790 123 / 2e-36 SNARE-like superfamily protein (.1)
AT3G50860 105 / 4e-29 Clathrin adaptor complex small chain family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042352 328 / 9e-117 AT2G17380 297 / 3e-104 associated protein 19 (.1)
Lus10003641 228 / 3e-77 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2)
Lus10024337 172 / 2e-54 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1)
Lus10012924 122 / 6e-36 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1)
Lus10035004 112 / 2e-32 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1)
Lus10041742 100 / 7e-27 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1)
Lus10024011 85 / 5e-21 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G052000 286 / 8e-101 AT2G17380 307 / 6e-109 associated protein 19 (.1)
Potri.002G001800 287 / 1e-100 AT2G17380 278 / 3e-97 associated protein 19 (.1)
Potri.014G079000 282 / 6e-99 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2)
Potri.005G238701 171 / 2e-55 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1)
Potri.002G022900 167 / 6e-54 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1)
Potri.006G149100 124 / 7e-37 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1)
Potri.007G025400 117 / 1e-33 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1)
Potri.005G122900 114 / 8e-33 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10026316 pacid=23156552 polypeptide=Lus10026316 locus=Lus10026316.g ID=Lus10026316.BGIv1.0 annot-version=v1.0
ATGGAGGGTGGGAGAGCATTTCGCGGAATTCACTTCGTTCTTCTCATCAGTCGTCAGGGGAAAGTGAGGCTGACGAAATGGTACTCTCCTTACACCCAGA
AGGAACGATCTAAGGTCATCAGGGAGCTGAGTGGAATAGTGCTGAATCGGGGTCCGAAGCTCTGCAATTTCGTCGAATGGAGAGGGTACAGGGTTATCTA
CAGGAGGTACGCAGGGTTGTATTTCTGCATGTGCATTGACGAGGCGGACAATGAGTTGGAGGTTCTTGACATCATTCACCACTTTGTCGAAATACTCGAT
CGATATTTCGGTAGCGTATGTGAATTGGACTTGATCTTCAATTTTCACAAGGCATACTACATACTGGATGAGACCCTGATAGCAGGGGAATTTCAGGAAT
CGAGTAAACGAGCTGTGATACGATTGATGTCCACGCATGATTCGATGGTGGAGATGGCCAAGGAGGAGGCCACTTCCATCAGCAATATGATTGCCCAAGT
CACCAAATAG
AA sequence
>Lus10026316 pacid=23156552 polypeptide=Lus10026316 locus=Lus10026316.g ID=Lus10026316.BGIv1.0 annot-version=v1.0
MEGGRAFRGIHFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGIVLNRGPKLCNFVEWRGYRVIYRRYAGLYFCMCIDEADNELEVLDIIHHFVEILD
RYFGSVCELDLIFNFHKAYYILDETLIAGEFQESSKRAVIRLMSTHDSMVEMAKEEATSISNMIAQVTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G17380 AP19 associated protein 19 (.1) Lus10026316 0 1
AT3G56960 PIP5K4 phosphatidyl inositol monophos... Lus10027306 8.8 0.8992
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10042506 22.0 0.8766
AT3G57030 Calcium-dependent phosphotries... Lus10009651 22.6 0.8066
AT1G18650 PDCB3 plasmodesmata callose-binding ... Lus10021157 27.4 0.8728
AT3G61430 ATPIP1, PIP1;1,... PLASMA MEMBRANE INTRINSIC PROT... Lus10026295 29.4 0.8724
AT5G14920 Gibberellin-regulated family p... Lus10039443 36.5 0.8712
AT2G20515 unknown protein Lus10022928 37.5 0.8704
AT2G42560 late embryogenesis abundant do... Lus10002197 39.3 0.8707
Lus10027902 40.9 0.8679
AT3G12210 DNA binding (.1.2) Lus10007717 48.5 0.8651

Lus10026316 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.