Lus10026325 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18870 279 / 1e-93 Mitochondrial transcription termination factor family protein (.1)
AT2G34620 144 / 7e-41 Mitochondrial transcription termination factor family protein (.1)
AT2G03050 139 / 5e-39 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
AT2G36000 116 / 5e-30 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
AT5G55580 86 / 2e-18 Mitochondrial transcription termination factor family protein (.1)
AT1G78930 86 / 2e-18 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 84 / 1e-17 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT4G38160 77 / 1e-15 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT4G14605 76 / 4e-15 Mitochondrial transcription termination factor family protein (.1)
AT2G44020 74 / 2e-14 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042342 595 / 0 AT3G18870 276 / 1e-92 Mitochondrial transcription termination factor family protein (.1)
Lus10014567 144 / 2e-40 AT2G34620 300 / 6e-101 Mitochondrial transcription termination factor family protein (.1)
Lus10032120 135 / 2e-37 AT2G34620 300 / 2e-101 Mitochondrial transcription termination factor family protein (.1)
Lus10029422 128 / 2e-34 AT2G36000 294 / 3e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10004219 123 / 3e-32 AT2G36000 293 / 8e-98 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10016971 122 / 3e-32 AT2G36000 271 / 2e-89 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10021297 121 / 7e-32 AT2G36000 264 / 8e-87 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Lus10030451 115 / 1e-29 AT2G03050 283 / 3e-95 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Lus10026612 110 / 7e-28 AT2G03050 285 / 4e-96 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G150600 303 / 6e-103 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1)
Potri.011G081400 161 / 3e-47 AT2G34620 392 / 5e-138 Mitochondrial transcription termination factor family protein (.1)
Potri.016G072200 136 / 2e-37 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.006G205000 132 / 6e-36 AT2G36000 284 / 2e-94 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Potri.010G167400 113 / 3e-29 AT2G03050 303 / 3e-103 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1)
Potri.001G361800 92 / 1e-20 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.007G001800 90 / 1e-19 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.004G209400 84 / 3e-18 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.009G170300 80 / 1e-16 AT4G38160 479 / 8e-170 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.017G067600 79 / 3e-16 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10026325 pacid=23156414 polypeptide=Lus10026325 locus=Lus10026325.g ID=Lus10026325.BGIv1.0 annot-version=v1.0
ATGCTACACTCACTAACTATCCAAGCTTCCTCCATAACCAGAACCTTCACCAAACACCCACCACCACCACCACCTACTCCATCTCCACACCCTCCCATTC
ACATTAACTTCCAAACAACCCGCCGAGAACATCTCCGATACCTCAAATCCATCGGCGTGGTTAGCCCCGACACCAAACTTCACAAGCTCCCATCACCGGA
CGCCATCTCCCACATCCTCTCCACCGTGAACTTCTTCAAATCTAAAGGCTTCTCCAACCCCGACTTCCCCAGGCTCGTCTCCGTTTGCCCCGAAATCTTC
TCTCCCAACTTCGATGTCTCCGACATTCAACCCGTGTTCGAGTTTCTCGCCATGGATTTGGGGGCCTCGCCCCACCAATCTTGCGGTCTGATCGCAAATT
GCCCCGAGATCCTCCTCACCGATGTGGAGTACTGCCTCAAGCCGACGCTGGACTATCTCAGGCATATTGGGGTGGAGAATTTGAATGCTCCTACAATCCT
CAACGCCAACCTGTTGAATGTTCGAATCGGGAAGTTGCAGTCGAAGGTGATGTTTCTGAGGAGCATTGGGTTTTCCGAGGAGGAAGCTGAGAAATGCTGT
GCGAGGTTGCCTGCCATATTGAAGTACAGCGTTGAGAATAATATGAAGAGGAAGTATGTGTACCTGGTGAAGGAGATGGGACGGAGCGTGGAGGAGTTGA
AGGAGTTCCCTCAGTATTTCGGGTTTAGTCTCGAGACGAGGATACACCCGAGGCATGTGTATCTGAAAGCCATGAACGTTAAGGCCAAGCTGGATAGAAT
GTTGAAATGTAGCGACGAGAATTTCTACTACCGCTTTTGGGAGAAACCTGGCCTTGCTGGGCGCAACAAATCCAGACATTCTAAGAGGATGAATCCGAGA
GGAGAAAAACGCATTTCGACCAATGCTCCGAGTCTGACACTCTGA
AA sequence
>Lus10026325 pacid=23156414 polypeptide=Lus10026325 locus=Lus10026325.g ID=Lus10026325.BGIv1.0 annot-version=v1.0
MLHSLTIQASSITRTFTKHPPPPPPTPSPHPPIHINFQTTRREHLRYLKSIGVVSPDTKLHKLPSPDAISHILSTVNFFKSKGFSNPDFPRLVSVCPEIF
SPNFDVSDIQPVFEFLAMDLGASPHQSCGLIANCPEILLTDVEYCLKPTLDYLRHIGVENLNAPTILNANLLNVRIGKLQSKVMFLRSIGFSEEEAEKCC
ARLPAILKYSVENNMKRKYVYLVKEMGRSVEELKEFPQYFGFSLETRIHPRHVYLKAMNVKAKLDRMLKCSDENFYYRFWEKPGLAGRNKSRHSKRMNPR
GEKRISTNAPSLTL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G18870 Mitochondrial transcription te... Lus10026325 0 1
AT5G20935 unknown protein Lus10013382 2.4 0.9377
AT3G63140 CSP41A chloroplast stem-loop binding ... Lus10014669 4.7 0.9461
AT3G21055 PSBTN photosystem II subunit T (.1) Lus10027359 5.1 0.9445
AT2G36145 unknown protein Lus10014224 5.2 0.9280
AT2G47400 CP12-1 CP12 domain-containing protein... Lus10025025 5.9 0.9326
AT1G51400 Photosystem II 5 kD protein (.... Lus10014908 7.5 0.9341
AT1G74070 Cyclophilin-like peptidyl-prol... Lus10008990 7.9 0.9315
AT3G05170 Phosphoglycerate mutase family... Lus10024659 8.7 0.9161
AT1G44920 unknown protein Lus10007720 9.5 0.9204
AT5G67385 Phototropic-responsive NPH3 fa... Lus10014858 9.9 0.9172

Lus10026325 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.