Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G11880 208 / 1e-66 Pyridoxal-dependent decarboxylase family protein (.1) AT3G14390 204 / 5e-65 Pyridoxal-dependent decarboxylase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042305 [exp] 222 / 4e-72 AT5G11880 806 / 0.0 Pyridoxal-dependent decarboxylase family protein (.1) Lus10023548 [exp] 215 / 3e-69 AT5G11880 809 / 0.0 Pyridoxal-dependent decarboxylase family protein (.1) Lus10040433 [exp] 214 / 4e-69 AT5G11880 813 / 0.0 Pyridoxal-dependent decarboxylase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G119300 [exp] 208 / 1e-66 AT5G11880 815 / 0.0 Pyridoxal-dependent decarboxylase family protein (.1) Potri.004G157500 [exp] 204 / 3e-65 AT5G11880 815 / 0.0 Pyridoxal-dependent decarboxylase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00278 [flax] [poplar] Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
Representative CDS sequence Show only first row Show all	>Lus10026354 pacid=23156466 polypeptide=Lus10026354 locus=Lus10026354.g ID=Lus10026354.BGIv1.0 annot-version=v1.0 ATGGCAGAGCTCATCCGTCCTAGTCTCTATGATGCTTATCAACACATAGAGCTTGTGTCTCCCTCGCCACCAAATGCTGAGGTACTAACCTTCGATGTCG TGGGTCCTGTGTGCGAGTCTGCCGATTTTTTGGGAAAGGAGAGAGAACGTCCTACGCCAGCCAAGGGAGAGGGTTTGGTTGTTCATGATGCGGGAGCTTA CTGCATGAGCATGGCATCAACATATAATCTGAAGATGCGCCCTTCAGAGTACTGGGTGGAGGAAGACGGATCAATAGCCAAAATCAGACATGTAGAGACA TTTGAAGACCATATCCGGTTCTTTGATGGCTTATAA
AA sequence Show only first row Show all	>Lus10026354 pacid=23156466 polypeptide=Lus10026354 locus=Lus10026354.g ID=Lus10026354.BGIv1.0 annot-version=v1.0 MAELIRPSLYDAYQHIELVSPSPPNAEVLTFDVVGPVCESADFLGKERERPTPAKGEGLVVHDAGAYCMSMASTYNLKMRPSEYWVEEDGSIAKIRHVET FEDHIRFFDGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G11880			Pyridoxal-dependent decarboxyl...		Lus10026354 [exp]	0	1
AT5G24070			Peroxidase superfamily protein...		Lus10027049 [exp]	5.1	1.0000
AT2G36190		ATCWINV4	cell wall invertase 4 (.1)		Lus10014217 [exp]	5.6	1.0000
AT4G35500			Protein kinase superfamily pro...		Lus10016690 [exp]	8.2	1.0000
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10027891 [exp]	11.0	1.0000
AT5G14760		AO	L-aspartate oxidase (.1)		Lus10018901 [exp]	12.4	1.0000
AT3G16857	GARP	ARR1	response regulator 1 (.1.2)		Lus10039345 [exp]	13.5	1.0000
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10036896 [exp]	15.3	1.0000
					Lus10020402 [exp]	15.9	1.0000
					Lus10021815 [exp]	16.7	1.0000
AT5G45890		SAG12	senescence-associated gene 12 ...		Lus10020731 [exp]	18.3	1.0000

Compare expression of checked genes

Lus10026354 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.