Lus10026357 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G17860 182 / 5e-58 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73260 113 / 4e-31 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
AT1G73325 105 / 6e-28 Kunitz family trypsin and protease inhibitor protein (.1)
AT1G73330 92 / 7e-23 ATDR4 drought-repressed 4 (.1)
AT1G72290 51 / 1e-07 Kunitz family trypsin and protease inhibitor protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042301 425 / 9e-154 AT1G17860 182 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039209 360 / 4e-128 AT1G17860 179 / 6e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039210 357 / 4e-127 AT1G17860 179 / 4e-57 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10022302 360 / 2e-126 AT1G17860 176 / 4e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013730 353 / 1e-125 AT1G17860 175 / 2e-55 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013731 355 / 1e-124 AT1G17860 172 / 5e-53 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10013732 329 / 5e-116 AT1G17860 166 / 4e-52 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10039208 328 / 1e-115 AT1G17860 172 / 2e-54 Kunitz family trypsin and protease inhibitor protein (.1)
Lus10011090 318 / 2e-111 AT1G17860 161 / 4e-50 Kunitz family trypsin and protease inhibitor protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G153400 207 / 9e-68 AT1G17860 223 / 1e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153466 206 / 2e-67 AT1G17860 222 / 4e-74 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153600 201 / 2e-65 AT1G17860 217 / 3e-72 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067600 196 / 3e-63 AT1G17860 196 / 9e-64 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067900 191 / 2e-61 AT1G17860 183 / 2e-58 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.017G153200 175 / 3e-55 AT1G17860 191 / 5e-62 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.004G067800 148 / 9e-45 AT1G17860 137 / 8e-41 Kunitz family trypsin and protease inhibitor protein (.1)
Potri.019G006900 96 / 1e-24 AT1G73260 79 / 6e-18 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.004G000400 88 / 2e-21 AT1G73260 91 / 9e-23 ARABIDOPSIS THALIANA KUNITZ TRYPSIN INHIBITOR 1, kunitz trypsin inhibitor 1 (.1)
Potri.001G309900 85 / 2e-20 AT1G17860 90 / 2e-22 Kunitz family trypsin and protease inhibitor protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0066 Trefoil PF00197 Kunitz_legume Trypsin and protease inhibitor
Representative CDS sequence
>Lus10026357 pacid=23156589 polypeptide=Lus10026357 locus=Lus10026357.g ID=Lus10026357.BGIv1.0 annot-version=v1.0
ATGAAGGCAACAATGCTACTTCTATCTTCATTCATCATAGTCCTAGCCACCTTCACCACAAAACTCCCCGTTTCATCCGCAGCATCCCCAGTCCCCGTAA
CCGACGTGGACGGCACGCCCCTCCGATCGGGTCTCAAGTACTTCATCCTCCCATCCGTCTCCGGAAACGGCGGGGGCATCTTTCTAGACCGAACCAAGAC
CAAGAAATGCCCGCTCTCCGTATTCCAAGACGACTACGAGCTCTCCAAGGGTCTCCCCGTAGTTTTCCTTCCAGTCAACTCCGCCAAGCCGGGCTACACC
GTTCAGACCGCCACTGACCTCAACATCGAGTTCACCGCCGAGACTGCTTGCGACGAGGCCACCGTGTGGAAGGTGGAGAGTTACGACGACGACGTGAAGC
AGTGGTTCGTCGGGACGGGTGGGGTCGAAGGGAAGCCCGGGCCGAGGACGGTGGAGAACTGGTTTAAGATTGCGAAATACGGCGGGAACTACAAGCTGGT
GTACTGCCCTTCTGTGTGTAAGTCGTGTAAAGTTCAGTGTAAGGATGTTGGGGTTTACGAGGATGAAGATGGGAAGAAGAGGCTTGCTCTTACTAGTACT
GGTGATGATCAGCCTTTTGTTGTTAAGTTCGTCAAGGCTCCTAACAATGCTTAA
AA sequence
>Lus10026357 pacid=23156589 polypeptide=Lus10026357 locus=Lus10026357.g ID=Lus10026357.BGIv1.0 annot-version=v1.0
MKATMLLLSSFIIVLATFTTKLPVSSAASPVPVTDVDGTPLRSGLKYFILPSVSGNGGGIFLDRTKTKKCPLSVFQDDYELSKGLPVVFLPVNSAKPGYT
VQTATDLNIEFTAETACDEATVWKVESYDDDVKQWFVGTGGVEGKPGPRTVENWFKIAKYGGNYKLVYCPSVCKSCKVQCKDVGVYEDEDGKKRLALTST
GDDQPFVVKFVKAPNNA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G17860 Kunitz family trypsin and prot... Lus10026357 0 1
AT1G21326 VQ motif-containing protein (.... Lus10012286 1.4 0.9967
AT1G17860 Kunitz family trypsin and prot... Lus10039163 1.4 0.9958
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10030931 2.4 0.9931
AT1G17860 Kunitz family trypsin and prot... Lus10042301 3.5 0.9888
Lus10043316 4.5 0.9928
AT2G19070 SHT spermidine hydroxycinnamoyl tr... Lus10005358 4.6 0.9818
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10029368 4.9 0.9851
AT5G09360 LAC14 laccase 14 (.1) Lus10006157 5.7 0.9874
AT1G79460 ATKS1, ATKS, GA... GA REQUIRING 2, ARABIDOPSIS TH... Lus10024120 5.9 0.9925
AT4G23690 Disease resistance-responsive ... Lus10024715 5.9 0.9874

Lus10026357 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.