Lus10026384 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07080 265 / 4e-89 Thioredoxin superfamily protein (.1)
AT5G01580 204 / 2e-65 OSH1 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12890 177 / 5e-55 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12900 172 / 5e-53 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12870 160 / 1e-48 Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
AT4G12960 156 / 6e-47 GILT, AtGILT gamma-interferon-responsive lysosomal thiol reductase, Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1), Gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042270 461 / 3e-166 AT1G07080 285 / 5e-97 Thioredoxin superfamily protein (.1)
Lus10002203 202 / 9e-65 AT5G01580 238 / 2e-79 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Lus10022669 167 / 4e-51 AT1G07080 170 / 2e-52 Thioredoxin superfamily protein (.1)
Lus10012503 167 / 5e-51 AT1G07080 171 / 1e-52 Thioredoxin superfamily protein (.1)
Lus10022670 169 / 1e-48 AT4G00620 527 / 0.0 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Lus10012502 155 / 4e-43 AT4G00620 442 / 6e-152 EMBRYO DEFECTIVE 3127, Amino acid dehydrogenase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G076200 325 / 9e-113 AT1G07080 278 / 3e-94 Thioredoxin superfamily protein (.1)
Potri.001G281004 297 / 3e-102 AT1G07080 266 / 8e-90 Thioredoxin superfamily protein (.1)
Potri.016G121900 227 / 2e-74 AT5G01580 263 / 3e-89 OAS HIGH ACCUMULATION 1, gamma interferon responsive lysosomal thiol (GILT) reductase family protein (.1)
Potri.012G107600 212 / 3e-68 AT1G07080 204 / 2e-65 Thioredoxin superfamily protein (.1)
Potri.012G107300 210 / 1e-67 AT1G07080 205 / 1e-65 Thioredoxin superfamily protein (.1)
Potri.016G122200 206 / 7e-66 AT1G07080 204 / 3e-65 Thioredoxin superfamily protein (.1)
Potri.006G103000 196 / 3e-62 AT1G07080 196 / 3e-62 Thioredoxin superfamily protein (.1)
Potri.016G122000 174 / 6e-54 AT1G07080 185 / 3e-58 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF03227 GILT Gamma interferon inducible lysosomal thiol reductase (GILT)
Representative CDS sequence
>Lus10026384 pacid=23156439 polypeptide=Lus10026384 locus=Lus10026384.g ID=Lus10026384.BGIv1.0 annot-version=v1.0
ATGGCTTCTCCTCCGCGCATCTCCTCCTTCGTCTGCTTGTTGCTACTGTTTTCCTCGTTCTCTTTCAGTAATTCGTCTTCCTATGCCCCCAGCTCGACGG
ATTCCAGCAGCGAGAAGGTCTCTCTGGCTCTGTACTACGAGTCTCTCTGTCCATACAGCGCCAATTTCATCGTGAACTACCTGGTTCGCGTCTTTGAAGA
CGACGAGCTCTTATCCATCGTCGATCTCTACCTCTCTCCCTGGGGCAACGCCAAGCTCAGATCCAATGACACCTTCGTCTGCCAGCATGGACCAGTTGAG
TGCTTACTTAATACAGTGGAAGCTTGTGCCATTGATGCTTGGCCTAAACTGGATAAGCATTTTCCATTCATCTATTGCGTTGAGGAGAAGGTCTTTGAAC
GTAAGCCCATGGAGTGGGAGTCTTGCTTTGGGGAGCTGGCTTTGGATCAACAAATTATTCAGGATTGCTACGGCAGTGGATATGGCAAGAAGCTGGAATT
AAAGTATGCAGCTGAAACTAATGCTCTTACGCCTGCTCATCAATATGTTCCATGGGTGGTCGTGAATGGACAGCCACTTTACGAGGACTACGAAAACTTC
ATCAATTACATCTGCAAGGCCTACAAGGGCACTGCTATTCCAAAAGCTTGCAGCGAGGCAAGTGTAATCCGGAACCAGAAACCAACGTTGGTTCCAGCCT
GCTACAAGGACGGGCACCCAAAGATGTCGAAGCTATCGAAGATAGTAAAGTCGGCCATATCGACATGGGTGCATGCGATGGAGGGTTAA
AA sequence
>Lus10026384 pacid=23156439 polypeptide=Lus10026384 locus=Lus10026384.g ID=Lus10026384.BGIv1.0 annot-version=v1.0
MASPPRISSFVCLLLLFSSFSFSNSSSYAPSSTDSSSEKVSLALYYESLCPYSANFIVNYLVRVFEDDELLSIVDLYLSPWGNAKLRSNDTFVCQHGPVE
CLLNTVEACAIDAWPKLDKHFPFIYCVEEKVFERKPMEWESCFGELALDQQIIQDCYGSGYGKKLELKYAAETNALTPAHQYVPWVVVNGQPLYEDYENF
INYICKAYKGTAIPKACSEASVIRNQKPTLVPACYKDGHPKMSKLSKIVKSAISTWVHAMEG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07080 Thioredoxin superfamily protei... Lus10026384 0 1
AT4G29960 unknown protein Lus10001629 3.0 0.9040
AT1G06400 ARA2, AtRABA1a,... ARABIDOPSIS THALIANA RAB GTPAS... Lus10029789 3.9 0.8839
AT5G03460 unknown protein Lus10014419 6.3 0.8847
AT4G23430 AtTic32-IVa translocon at the inner envelo... Lus10035481 7.4 0.8788
AT1G79230 STR1, ATRDH1, A... ARABIDOPSIS THALIANA RHODANESE... Lus10031753 9.8 0.8489
AT1G11910 ATAPA1, APA1 aspartic proteinase A1 (.1) Lus10032636 10.4 0.8788
AT5G45660 unknown protein Lus10002778 11.2 0.8602
AT5G56340 ATCRT1 RING/U-box superfamily protein... Lus10013397 14.2 0.8718
AT3G54840 ARA6, AtRABF1, ... Ras-related small GTP-binding ... Lus10017462 14.8 0.8812
AT2G29960 CYP19-4, ATCYP5... CYCLOPHILIN 19-4, ARABIDOPSIS ... Lus10018238 15.3 0.8595

Lus10026384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.