Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G19130 73 / 2e-16 S-locus lectin protein kinase family protein (.1) AT1G34300 54 / 1e-09 lectin protein kinase family protein (.1) AT2G41890 53 / 2e-09 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1) AT5G24080 51 / 8e-09 Protein kinase superfamily protein (.1) AT4G00340 50 / 1e-08 RLK4 receptor-like protein kinase 4 (.1) AT4G32300 46 / 5e-07 SD2-5 S-domain-2 5 (.1) AT5G60900 45 / 1e-06 RLK1 receptor-like protein kinase 1 (.1) AT1G16670 40 / 4e-05 Protein kinase superfamily protein (.1) AT4G02010 39 / 0.0001 Protein kinase superfamily protein (.1) AT1G56145 38 / 0.0003 Leucine-rich repeat transmembrane protein kinase (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042266 [exp] 146 / 2e-42 AT2G19130 775 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10031597 [exp] 68 / 8e-16 AT2G19130 145 / 3e-41 S-locus lectin protein kinase family protein (.1) Lus10033748 [exp] 66 / 6e-14 AT2G19130 711 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10029802 [exp] 65 / 1e-13 AT2G19130 729 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039762 [exp] 64 / 2e-13 AT2G19130 621 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10039732 [exp] 62 / 2e-12 AT2G19130 647 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10018537 [exp] 57 / 6e-12 AT2G19130 113 / 4e-30 S-locus lectin protein kinase family protein (.1) Lus10013252 [exp] 55 / 6e-10 AT1G34300 378 / 7e-119 lectin protein kinase family protein (.1) Lus10028711 [exp] 53 / 2e-09 AT1G34300 704 / 0.0 lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G121000 [exp] 72 / 3e-16 AT2G19130 863 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.019G119200 [exp] 72 / 5e-16 AT2G19130 874 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.013G149500 [exp] 71 / 1e-15 AT2G19130 838 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.014G086900 [exp] 63 / 5e-13 AT4G00340 862 / 0.0 receptor-like protein kinase 4 (.1) Potri.013G115800 [exp] 57 / 8e-11 AT1G34300 858 / 0.0 lectin protein kinase family protein (.1) Potri.019G086300 [exp] 56 / 2e-10 AT1G34300 847 / 0.0 lectin protein kinase family protein (.1) Potri.015G026300 [exp] 55 / 4e-10 AT5G24080 684 / 0.0 Protein kinase superfamily protein (.1) Potri.011G003900 [exp] 54 / 1e-09 AT5G38280 413 / 1e-135 PR5-like receptor kinase (.1) Potri.010G103300 [exp] 52 / 4e-09 AT1G34300 375 / 1e-117 lectin protein kinase family protein (.1) Potri.006G053700 [exp] 50 / 2e-08 AT2G41890 765 / 0.0 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026391 pacid=23156625 polypeptide=Lus10026391 locus=Lus10026391.g ID=Lus10026391.BGIv1.0 annot-version=v1.0 ATGGATGTGATAAATGAAAACGAGGATCTGCTTAGCCTGTTGGATCCCCGACTTGACAGGAAAGGTGATGTGGAGGAGATCATAAGGGTGTGTAAGATCG CTTGCTGGTGTATCCAGGATCGAGAGGAACTTCGGCCGACCATGGGACAGGTGGTCCAGATTCTAGAAGGGAATTTTGAGGTGGGATGGCCATCGATTCC GAATGTTCTCCGGTTACTTTTGGACGACGAGGAGCAGCTTACTCTGTATAGTGAATACTCATCATGTCCAGCGGTGAAGCCCTAA
AA sequence Show only first row Show all	>Lus10026391 pacid=23156625 polypeptide=Lus10026391 locus=Lus10026391.g ID=Lus10026391.BGIv1.0 annot-version=v1.0 MDVINENEDLLSLLDPRLDRKGDVEEIIRVCKIACWCIQDREELRPTMGQVVQILEGNFEVGWPSIPNVLRLLLDDEEQLTLYSEYSSCPAVKP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G19130			S-locus lectin protein kinase ...		Lus10026391 [exp]	0	1
AT1G02335		GL22	germin-like protein subfamily ...		Lus10004858 [exp]	1.0	0.9765
AT1G11410			S-locus lectin protein kinase ...		Lus10007609 [exp]	5.3	0.9525
AT4G18930			RNA ligase/cyclic nucleotide p...		Lus10002767 [exp]	7.3	0.9531
AT2G47710			Adenine nucleotide alpha hydro...		Lus10006701 [exp]	7.9	0.9718
AT1G72360	AP2_ERF	AtERF73, HRE1	HYPOXIA RESPONSIVE ERF \(ETHYL...		Lus10003601 [exp]	8.2	0.9723
AT1G14540			Peroxidase superfamily protein...		Lus10000003 [exp]	9.9	0.9695
AT5G62020	HSF	AT-HSFB2A	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10011185 [exp]	11.0	0.9701
AT4G01250	WRKY	ATWRKY22, WRKY2...	WRKY family transcription fact...		Lus10024676 [exp]	11.2	0.9700
AT1G14540			Peroxidase superfamily protein...		Lus10009904 [exp]	12.5	0.9699
					Lus10019232 [exp]	14.4	0.9669

Compare expression of checked genes

Lus10026391 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.