Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G07020 62 / 7e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042256 [exp] 115 / 4e-34 AT1G07020 107 / 1e-29 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G077700 [exp] 66 / 4e-15 AT1G07020 99 / 1e-26 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026396 pacid=23156461 polypeptide=Lus10026396 locus=Lus10026396.g ID=Lus10026396.BGIv1.0 annot-version=v1.0 ATGAACCGGTGGAATGCTCCGCTAACGGCGGAGAGCTCGACGAGAGTAATGGAGGCGATGCGTGGGATCTCCTTCGTCAGTTCAGCTCCTGAGTGGGCTG TCCGAGTTCCCGAGACTCAGTGGATTGATCAGATCAGAAGGATGCGGCAGTTGCACCAACCTTCTGGTTCTGCTGCTGGAAACTAG
AA sequence Show only first row Show all	>Lus10026396 pacid=23156461 polypeptide=Lus10026396 locus=Lus10026396.g ID=Lus10026396.BGIv1.0 annot-version=v1.0 MNRWNAPLTAESSTRVMEAMRGISFVSSAPEWAVRVPETQWIDQIRRMRQLHQPSGSAAGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G07020			unknown protein		Lus10026396 [exp]	0	1
AT2G44840	AP2_ERF	ATERF13, EREBP	ethylene-responsive element bi...		Lus10029314 [exp]	1.0	0.7732
AT1G60630			Leucine-rich repeat protein ki...		Lus10019429 [exp]	10.5	0.6941
					Lus10022893 [exp]	14.3	0.6014
AT1G10200	LIM	WLIM1, SF3	WLIM1, GATA type zinc finger t...		Lus10027305 [exp]	21.4	0.5864
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	27.9	0.5918
					Lus10042238 [exp]	29.3	0.5835
AT1G02030	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10031166 [exp]	31.7	0.5814
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	32.8	0.5896
AT4G00350			MATE efflux family protein (.1...		Lus10036374 [exp]	32.9	0.5891
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	35.1	0.5896

Compare expression of checked genes

Lus10026396 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.