Lus10026404 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G56110 199 / 1e-64 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT2G38360 196 / 2e-63 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT5G01640 184 / 1e-58 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G05380 182 / 5e-58 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT5G07110 182 / 6e-58 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT2G40380 176 / 8e-56 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT4G00005 96 / 1e-25 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 93 / 2e-23 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G04260 85 / 2e-20 PRA1.D, MPIP7, MPI7 PRENYLATED RAB ACCEPTOR 1.D, CAMV movement protein interacting protein 7 (.1)
AT1G08770 84 / 9e-20 PRA1.E prenylated RAB acceptor 1.E (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042246 293 / 2e-101 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10012224 204 / 2e-66 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10002853 200 / 1e-64 AT2G38360 305 / 4e-106 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 187 / 1e-59 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 185 / 3e-59 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 185 / 5e-59 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 155 / 4e-48 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014747 103 / 3e-27 AT1G55190 147 / 9e-45 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Lus10034363 102 / 9e-27 AT1G55190 197 / 1e-64 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G183300 208 / 2e-68 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.019G124100 199 / 7e-65 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.008G074000 192 / 3e-62 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 192 / 3e-62 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.006G104400 192 / 7e-62 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.016G126400 187 / 6e-60 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.005G219100 122 / 1e-34 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 119 / 1e-33 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G044000 113 / 4e-31 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G043800 109 / 6e-30 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10026404 pacid=23156513 polypeptide=Lus10026404 locus=Lus10026404.g ID=Lus10026404.BGIv1.0 annot-version=v1.0
ATGACCTCGGCTCCTTCGATTCCGCTCTCCAGCCAAGATTCCGGCGCCGCTGCCTCCTCCTCCGCTGTACCTCCTTCAGTTGTCGCCGCGGTCCGCTCCT
TCGTCGGCAGGCTCTACTCCTCAGTCAGCCAATCGCTGTCCAACCGCCGCCCATGGACGGAGCTCATCGACCGCTCTGCCTTCTCGAGGCCGGAATCTCT
CTCCGACGCCACCACCAGGATACGCAAGAACTACTCCTACTTCCGCGTCAACTACACAACTCTGCTTGCGATCGTCCTCGCCGTCTCCCTAATCTCCCAT
CCTTTCTCTCTCATCACGCTCCTCTCCCTGCTCGCGGCGTGGCTGTTCCTCTACTCGTTCCGGCCCTCGGATCAGCCGCTGGTGGTGATGGGCCGGACCT
TCTCGGACCGGGAGACGCTCGGGATCTTGATGCTGGTGACCGTGGTGGTGATCTTCTTGACGAGCGTCGGATCGCTACTGATCTCGGCGACGATGGTTGG
AGTCGCGATTGTTTGCGTCCACGGCGCGTTTAGAGATCCGGAGGATCTATTCATGGATGAGCAGGAAGGAGGTGGCGCTGGACTGTTCTCGTTCATCGGT
GGATCGGCCACTGCCGCCGGGAGTAGCATGATGTCGCGCGTGTGA
AA sequence
>Lus10026404 pacid=23156513 polypeptide=Lus10026404 locus=Lus10026404.g ID=Lus10026404.BGIv1.0 annot-version=v1.0
MTSAPSIPLSSQDSGAAASSSAVPPSVVAAVRSFVGRLYSSVSQSLSNRRPWTELIDRSAFSRPESLSDATTRIRKNYSYFRVNYTTLLAIVLAVSLISH
PFSLITLLSLLAAWLFLYSFRPSDQPLVVMGRTFSDRETLGILMLVTVVVIFLTSVGSLLISATMVGVAIVCVHGAFRDPEDLFMDEQEGGGAGLFSFIG
GSATAAGSSMMSRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10026404 0 1
AT5G40150 Peroxidase superfamily protein... Lus10014517 1.4 0.8974
AT5G07720 Galactosyl transferase GMA12/M... Lus10000563 2.8 0.8808
AT1G04980 ATPDI10, ATPDIL... ARABIDOPSIS THALIANA PROTEIN D... Lus10031522 4.5 0.8735
AT4G29870 Oligosaccharyltransferase comp... Lus10003228 5.1 0.8838
AT1G32860 Glycosyl hydrolase superfamily... Lus10001660 5.5 0.8607
AT1G14360 ATUTR3, UTR3 UDP-galactose transporter 3 (.... Lus10030495 5.7 0.8692
AT3G44150 unknown protein Lus10016181 5.7 0.8809
AT4G25680 PPPDE putative thiol peptidase... Lus10039275 7.9 0.8668
AT5G40150 Peroxidase superfamily protein... Lus10032170 8.1 0.8517
AT4G28230 unknown protein Lus10033724 8.7 0.8440

Lus10026404 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.