Lus10026410 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22590 81 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1)
AT5G49690 78 / 2e-17 UDP-Glycosyltransferase superfamily protein (.1)
AT5G65550 77 / 2e-17 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36780 53 / 1e-08 UDP-Glycosyltransferase superfamily protein (.1)
AT4G34131 52 / 2e-08 UGT73B3 UDP-glucosyl transferase 73B3 (.1)
AT4G34135 51 / 3e-08 UGT73B2 UDP-glucosyltransferase 73B2 (.1.2)
AT2G36750 51 / 3e-08 UGT73C1, UGT72C1 UDP-glucosyl transferase 73C1 (.1)
AT2G36770 50 / 7e-08 UDP-Glycosyltransferase superfamily protein (.1)
AT2G36760 50 / 1e-07 UGT73C2 UDP-glucosyl transferase 73C2 (.1)
AT4G09500 49 / 2e-07 UDP-Glycosyltransferase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042242 141 / 6e-42 AT5G65550 280 / 9e-92 UDP-Glycosyltransferase superfamily protein (.1)
Lus10042241 120 / 1e-35 AT5G65550 168 / 4e-51 UDP-Glycosyltransferase superfamily protein (.1)
Lus10026412 102 / 3e-28 AT2G22590 173 / 1e-52 UDP-Glycosyltransferase superfamily protein (.1)
Lus10026411 92 / 6e-25 AT5G65550 94 / 8e-24 UDP-Glycosyltransferase superfamily protein (.1)
Lus10035951 90 / 2e-21 AT2G22590 464 / 3e-161 UDP-Glycosyltransferase superfamily protein (.1)
Lus10025711 88 / 5e-21 AT2G22590 473 / 2e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10012726 75 / 2e-16 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10027850 75 / 3e-16 AT5G49690 560 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10014438 52 / 1e-08 AT2G36780 206 / 2e-63 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G030600 93 / 8e-23 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.010G182575 86 / 3e-20 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.012G034100 80 / 3e-18 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1)
Potri.003G184400 74 / 5e-16 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.014G088400 72 / 2e-15 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.002G162300 67 / 1e-13 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G042800 66 / 4e-13 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G041900 52 / 1e-08 AT5G54010 348 / 1e-116 UDP-Glycosyltransferase superfamily protein (.1)
Potri.016G097400 50 / 1e-07 AT3G53150 626 / 0.0 UDP-glucosyl transferase 73D1 (.1)
Potri.006G179700 49 / 3e-07 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026410 pacid=23156538 polypeptide=Lus10026410 locus=Lus10026410.g ID=Lus10026410.BGIv1.0 annot-version=v1.0
ATGGCGGACGACGAAATCCACAAGAAGCTCCACATCGCGGTCTTCCCATGGCTAGCTTTCGGCCACATGATTCCATTCCTCGAGATCTCCAAGCTCTTAC
CCCAAAAAGGCCACTCAGTTTCCTACATCTCAACACCACGTAACATCAACCGTCCCCCCCAATTCCCTCCTCATCTTGCCCATATGTCGGATCAGGGGCT
GATCGCGAGGGTGTTTGCGGAGAAGGAGGTCGGTGTTGAGATTCCGAGGGACGAAGAGGACGGGGCTTTCTCGAGAGGAGATGAGGAGGCGACGGTGAGG
ACGATGGTGGCGGAGGAGAAGGAGAAGGTGTTTGGGAATCGAGAGGTTCATGATCGTTGCTTTGCTGAGTTTGTGAGGTTTCTTGAAGATCGTCGTAGAA
ACAAGGCGTTGGACGAGACACCTGGTAAATTGAGGATTACTTAA
AA sequence
>Lus10026410 pacid=23156538 polypeptide=Lus10026410 locus=Lus10026410.g ID=Lus10026410.BGIv1.0 annot-version=v1.0
MADDEIHKKLHIAVFPWLAFGHMIPFLEISKLLPQKGHSVSYISTPRNINRPPQFPPHLAHMSDQGLIARVFAEKEVGVEIPRDEEDGAFSRGDEEATVR
TMVAEEKEKVFGNREVHDRCFAEFVRFLEDRRRNKALDETPGKLRIT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G65550 UDP-Glycosyltransferase superf... Lus10026410 0 1
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10020950 9.9 0.6129
AT5G67300 MYB ATMYB44, AtMYBr... ARABIDOPSIS THALIANA MYB DOMAI... Lus10019314 72.8 0.5795
AT3G18650 MADS AGL103 AGAMOUS-like 103 (.1) Lus10022594 81.2 0.5233
AT2G24610 ATCNGC14 cyclic nucleotide-gated channe... Lus10026924 106.6 0.5601
AT5G65550 UDP-Glycosyltransferase superf... Lus10026411 109.2 0.5203
AT1G32340 NHL8 NDR1/HIN1-like 8 (.1) Lus10004569 136.9 0.5522
AT3G11770 Polynucleotidyl transferase, r... Lus10036491 139.0 0.5272
AT4G28703 RmlC-like cupins superfamily p... Lus10025947 145.9 0.5262
AT1G13510 Protein of unknown function (D... Lus10031915 222.5 0.5147
AT1G03050 ENTH/ANTH/VHS superfamily prot... Lus10000201 232.9 0.5028

Lus10026410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.