Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G65550 94 / 1e-23 UDP-Glycosyltransferase superfamily protein (.1) AT2G22590 77 / 1e-17 UDP-Glycosyltransferase superfamily protein (.1) AT5G49690 59 / 3e-11 UDP-Glycosyltransferase superfamily protein (.1) AT5G26310 42 / 2e-05 UGT72E3 UDP-Glycosyltransferase superfamily protein (.1) AT5G66690 38 / 0.0006 UGT72E2 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042242 [exp] 154 / 2e-47 AT5G65550 280 / 9e-92 UDP-Glycosyltransferase superfamily protein (.1) Lus10026410 [exp] 93 / 4e-25 AT5G65550 82 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1) Lus10012726 [exp] 88 / 2e-21 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1) Lus10025711 [exp] 81 / 5e-19 AT2G22590 473 / 2e-164 UDP-Glycosyltransferase superfamily protein (.1) Lus10035951 [exp] 80 / 1e-18 AT2G22590 464 / 3e-161 UDP-Glycosyltransferase superfamily protein (.1) Lus10027850 [exp] 74 / 1e-16 AT5G49690 560 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10043445 [exp] 52 / 1e-08 AT5G65550 225 / 3e-68 UDP-Glycosyltransferase superfamily protein (.1) Lus10028864 [exp] 45 / 2e-06 AT5G65550 154 / 1e-42 UDP-Glycosyltransferase superfamily protein (.1) Lus10008956 [exp] 44 / 5e-06 AT5G65550 189 / 1e-54 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G182575 [exp] 104 / 2e-27 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1) Potri.012G034100 [exp] 87 / 4e-21 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1) Potri.001G030600 [exp] 84 / 4e-20 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G042800 [exp] 74 / 1e-16 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1) Potri.014G088400 [exp] 73 / 3e-16 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1) Potri.017G042650 [exp] 67 / 1e-15 AT5G49690 67 / 2e-14 UDP-Glycosyltransferase superfamily protein (.1) Potri.003G184400 [exp] 70 / 3e-15 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Potri.002G162300 [exp] 69 / 6e-15 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1) Potri.018G140401 [exp] 50 / 2e-09 AT2G22590 88 / 3e-22 UDP-Glycosyltransferase superfamily protein (.1) Potri.010G182650 [exp] 49 / 5e-08 AT5G65550 254 / 4e-82 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026411 pacid=23156420 polypeptide=Lus10026411 locus=Lus10026411.g ID=Lus10026411.BGIv1.0 annot-version=v1.0 ATGGAAGCGCTTCGGTTCGGGGTCCCATTGATAATGCTGCCGGTACATGTGCCGGATCAGGGGATTAATGCGAGGGTGATGTCGGAGAAGGAGATTGGGA TTGAGATTCCGAGGAACGATGACGATGGGGCTTTCGTGAGAGGAGATGTGGCGGAGACGGTGAGGCTGGTGGTGGCGGAGAAAGAAGGACAGAGGTTTAG AGACCGAGCGGCGGGGGAGAGGGAGAAGCTGTTTGGGAATCCGGAGATTCACGATCGCTGCCTTGCTGAGTTTGTGAGGATTCTTGAAGAGCACCGGGGC AGTGTAGTTAGAGTGGTGGTTAATTGA
AA sequence Show only first row Show all	>Lus10026411 pacid=23156420 polypeptide=Lus10026411 locus=Lus10026411.g ID=Lus10026411.BGIv1.0 annot-version=v1.0 MEALRFGVPLIMLPVHVPDQGINARVMSEKEIGIEIPRNDDDGAFVRGDVAETVRLVVAEKEGQRFRDRAAGEREKLFGNPEIHDRCLAEFVRILEEHRG SVVRVVVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G65550			UDP-Glycosyltransferase superf...		Lus10026411 [exp]	0	1
AT2G22590			UDP-Glycosyltransferase superf...		Lus10026412 [exp]	1.0	0.6968
AT3G47570			Leucine-rich repeat protein ki...		Lus10030847 [exp]	16.8	0.6416
					Lus10039779 [exp]	17.9	0.6481
					Lus10029999 [exp]	22.4	0.6032
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Lus10041474 [exp]	24.8	0.5653
AT2G34930			disease resistance family prot...		Lus10024737 [exp]	25.9	0.6212
AT4G08850			Leucine-rich repeat receptor-l...		Lus10031161 [exp]	26.9	0.6154
					Lus10026392 [exp]	35.9	0.6173
AT3G47570			Leucine-rich repeat protein ki...		Lus10004388 [exp]	43.0	0.5893
AT3G26470			Powdery mildew resistance prot...		Lus10021768 [exp]	60.5	0.5646

Compare expression of checked genes

Lus10026411 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.