Lus10026412 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G22590 171 / 7e-52 UDP-Glycosyltransferase superfamily protein (.1)
AT5G49690 154 / 3e-45 UDP-Glycosyltransferase superfamily protein (.1)
AT5G65550 153 / 6e-45 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54060 91 / 4e-22 UF3GT UDP-glucose:flavonoid 3-o-glucosyltransferase (.1)
AT1G64920 89 / 5e-21 UDP-Glycosyltransferase superfamily protein (.1)
AT5G54010 86 / 3e-20 UDP-Glycosyltransferase superfamily protein (.1)
AT1G50580 82 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1)
AT2G22930 81 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1)
AT4G09500 81 / 2e-18 UDP-Glycosyltransferase superfamily protein (.1.2)
AT3G29630 80 / 5e-18 UDP-Glycosyltransferase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042241 211 / 2e-71 AT5G65550 168 / 4e-51 UDP-Glycosyltransferase superfamily protein (.1)
Lus10025711 160 / 1e-47 AT2G22590 473 / 2e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10035951 155 / 1e-45 AT2G22590 464 / 3e-161 UDP-Glycosyltransferase superfamily protein (.1)
Lus10012726 142 / 1e-40 AT2G22590 471 / 3e-164 UDP-Glycosyltransferase superfamily protein (.1)
Lus10027850 125 / 1e-34 AT5G49690 560 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10026410 102 / 4e-28 AT5G65550 82 / 1e-18 UDP-Glycosyltransferase superfamily protein (.1)
Lus10008453 98 / 2e-24 AT5G54010 539 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Lus10003154 92 / 5e-22 AT5G54010 318 / 3e-104 UDP-Glycosyltransferase superfamily protein (.1)
Lus10013337 88 / 8e-21 AT5G54010 452 / 1e-156 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G182575 164 / 5e-49 AT5G49690 468 / 7e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.001G030600 163 / 8e-49 AT2G22590 537 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.003G184400 147 / 1e-42 AT5G49690 549 / 0.0 UDP-Glycosyltransferase superfamily protein (.1)
Potri.014G088400 145 / 9e-42 AT2G22590 374 / 4e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.012G034100 144 / 1e-41 AT2G22590 505 / 2e-177 UDP-Glycosyltransferase superfamily protein (.1)
Potri.017G042800 136 / 1e-38 AT5G49690 377 / 3e-127 UDP-Glycosyltransferase superfamily protein (.1)
Potri.002G162300 135 / 2e-38 AT2G22590 372 / 6e-125 UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G097900 98 / 2e-24 AT5G54010 498 / 1e-174 UDP-Glycosyltransferase superfamily protein (.1)
Potri.011G061000 90 / 1e-21 AT5G54010 468 / 6e-163 UDP-Glycosyltransferase superfamily protein (.1)
Potri.006G179700 82 / 1e-18 AT5G54010 349 / 2e-116 UDP-Glycosyltransferase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026412 pacid=23156440 polypeptide=Lus10026412 locus=Lus10026412.g ID=Lus10026412.BGIv1.0 annot-version=v1.0
ATGGCGAACAAGGAAAGCAAGAAGCAGTTGCACATCGCAGTCTTCCCATGGCTGGCATACGGCCACTTGATTCCATTCCTAGAGCTCTCCAAGCTCTTAG
CCGAAAAAGGTCAATCAATTTCCTTCATTTCCACCCCACGTAACATCAACCGTCTCCCCCAAATCCCTCCTCATCTTTCTCATCTCATCAACTTCATCCC
CATTCCTCTTCCCGCCGGCGACGGGAACCTCCCCGATGGAGCAGAATCCACCTCCGACCTCCCCCGGCACCTTATCCCTCACCTCAAGCTCGCCTACGAC
GGTCTCGAACAGGAGGTGGACCAATTCTTCGAGGCCAGACGACCGGATTGGGTTATTCACGATTTCGCCCCATACTGGCTCCCGCGAATTGCAGTTAAGA
GCAACGTTTCCAGAGCTTTCTTCTCCACTATCTCGGCCGCCGCATGGTGCTTCTTCGGGCCGTTGGATTCCACATGA
AA sequence
>Lus10026412 pacid=23156440 polypeptide=Lus10026412 locus=Lus10026412.g ID=Lus10026412.BGIv1.0 annot-version=v1.0
MANKESKKQLHIAVFPWLAYGHLIPFLELSKLLAEKGQSISFISTPRNINRLPQIPPHLSHLINFIPIPLPAGDGNLPDGAESTSDLPRHLIPHLKLAYD
GLEQEVDQFFEARRPDWVIHDFAPYWLPRIAVKSNVSRAFFSTISAAAWCFFGPLDST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G22590 UDP-Glycosyltransferase superf... Lus10026412 0 1
AT5G65550 UDP-Glycosyltransferase superf... Lus10026411 1.0 0.6968
AT1G14870 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1... Lus10041474 11.7 0.5851
AT3G47570 Leucine-rich repeat protein ki... Lus10030847 15.1 0.6160
AT5G16080 ATCXE17 carboxyesterase 17 (.1) Lus10017587 18.6 0.6066
AT3G51070 S-adenosyl-L-methionine-depend... Lus10041804 22.6 0.5799
AT1G57790 F-box family protein (.1) Lus10019204 23.9 0.5732
AT4G05400 copper ion binding (.1.2) Lus10031070 31.1 0.6004
Lus10038304 35.3 0.5617
AT3G60730 Plant invertase/pectin methyle... Lus10009287 36.9 0.5291
AT2G34930 disease resistance family prot... Lus10024737 37.2 0.5890

Lus10026412 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.