Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38540 92 / 4e-25 ATLTP1, LP1 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) AT5G59320 88 / 9e-24 LTP3 lipid transfer protein 3 (.1) AT2G38530 88 / 2e-23 cdf3, LP2, LTP2 cell growth defect factor-3, lipid transfer protein 2 (.1) AT3G51600 80 / 2e-20 LTP5 lipid transfer protein 5 (.1) AT5G59310 79 / 4e-20 LTP4 lipid transfer protein 4 (.1) AT2G15050 76 / 5e-19 LTP7, LTP lipid transfer protein 7, lipid transfer protein (.1.2.3) AT5G01870 75 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G51590 75 / 2e-18 LTP12 lipid transfer protein 12 (.1) AT3G08770 69 / 4e-16 LTP6 lipid transfer protein 6 (.1.2) AT4G33355 65 / 2e-14 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025234 [exp] 132 / 5e-41 AT2G38530 118 / 2e-35 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10025152 [exp] 107 / 5e-31 AT2G38530 78 / 1e-23 cell growth defect factor-3, lipid transfer protein 2 (.1) Lus10014167 [exp] 92 / 5e-25 AT5G59310 102 / 2e-29 lipid transfer protein 4 (.1) Lus10022745 [exp] 86 / 9e-23 AT5G59310 103 / 1e-29 lipid transfer protein 4 (.1) Lus10015279 [exp] 83 / 1e-21 AT5G59320 116 / 6e-35 lipid transfer protein 3 (.1) Lus10025151 [exp] 76 / 1e-18 AT5G59320 103 / 1e-29 lipid transfer protein 3 (.1) Lus10015278 [exp] 74 / 2e-18 AT5G59310 110 / 1e-32 lipid transfer protein 4 (.1) Lus10007280 [exp] 70 / 3e-16 AT5G59310 90 / 2e-24 lipid transfer protein 4 (.1) Lus10025231 [exp] 70 / 3e-16 AT5G59320 99 / 5e-28 lipid transfer protein 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G086600 [exp] 93 / 2e-25 AT2G38540 122 / 3e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135400 [exp] 93 / 2e-25 AT5G59320 109 / 3e-32 lipid transfer protein 3 (.1) Potri.006G108100 [exp] 90 / 2e-24 AT2G38540 121 / 6e-37 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G136000 [exp] 90 / 3e-24 AT5G01870 113 / 1e-33 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.016G135800 [exp] 87 / 4e-23 AT5G01870 111 / 1e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.004G086500 [exp] 86 / 9e-23 AT2G38540 124 / 5e-38 ARABIDOPSIS THALIANA LIPID TRANSFER PROTEIN 1, lipid transfer protein 1 (.1) Potri.016G135500 [exp] 72 / 2e-17 AT5G59320 94 / 8e-26 lipid transfer protein 3 (.1) Potri.016G135700 [exp] 67 / 2e-15 AT5G59310 92 / 3e-25 lipid transfer protein 4 (.1) Potri.001G232700 [exp] 64 / 2e-14 AT2G18370 93 / 1e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G046500 [exp] 62 / 2e-13 AT4G33355 76 / 6e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10026418 pacid=23156406 polypeptide=Lus10026418 locus=Lus10026418.g ID=Lus10026418.BGIv1.0 annot-version=v1.0 ATGGAAGCAGCAGCGGCAATGAAGTTGGCCTCCGTGTTCCTCTTCTGCGCTTTGGTGGCTGCACCAATGATGAACGCCGGCGTCAGCGCCCTCTCCTGCG ACCAAGTGGACGGTGGGCTGGCCCCTTGCGTGTCTTACCTGACGGGACGTGGAGCCGTCACCCCTGGCTGCTGCAACGGCATGAAGGGGCTCCTCGTCGA GGCCAGGACCACCGCCGACCGCCGTCAGGCGTGCAACTGTTTGAAGTCCGCCGCCTCCAAACTGCCAGGGTTGAACCCCGCACTCGCCGCTGGGCTCCCC GGGAAATGCGGCGTCAAGATTCCTTACAAGATCAGCATCTCCACCAACTGCAACACGTAA
AA sequence Show only first row Show all	>Lus10026418 pacid=23156406 polypeptide=Lus10026418 locus=Lus10026418.g ID=Lus10026418.BGIv1.0 annot-version=v1.0 MEAAAAMKLASVFLFCALVAAPMMNAGVSALSCDQVDGGLAPCVSYLTGRGAVTPGCCNGMKGLLVEARTTADRRQACNCLKSAASKLPGLNPALAAGLP GKCGVKIPYKISISTNCNT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59320		LTP3	lipid transfer protein 3 (.1)		Lus10026418 [exp]	0	1
AT2G04570			GDSL-like Lipase/Acylhydrolase...		Lus10015162 [exp]	1.4	0.9528
AT1G31740		BGAL15	beta-galactosidase 15 (.1)		Lus10043422 [exp]	1.4	0.9415
AT2G26910		PEC1, ABCG32, P...	PERMEABLE CUTICLE 1, ATP-bindi...		Lus10043305 [exp]	1.7	0.9407
AT4G36930	bHLH	SPT, bHLH024	SPATULA, basic helix-loop-heli...		Lus10038020 [exp]	2.6	0.9322
AT3G19550			unknown protein		Lus10013900 [exp]	2.8	0.9377
AT1G15170			MATE efflux family protein (.1...		Lus10029694 [exp]	4.0	0.9316
AT2G16630			Pollen Ole e 1 allergen and ex...		Lus10042394 [exp]	4.5	0.9335
AT2G30580		BMI1A, DRIP2	DREB2A-interacting protein 2 (...		Lus10021993 [exp]	4.8	0.9056
AT4G27290			S-locus lectin protein kinase ...		Lus10006772 [exp]	7.5	0.9112
AT4G16780	HD	ATHB2, HAT4, AT...	ARABIDOPSIS THALIANA HOMEOBOX ...		Lus10040175 [exp]	7.9	0.9294

Compare expression of checked genes

Lus10026418 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.