Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G26040 256 / 2e-87 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT1G73000 212 / 6e-70 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1) AT4G17870 202 / 2e-66 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G40330 168 / 1e-52 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G46790 166 / 7e-52 RCAR12, PYL1 regulatory components of ABA receptor 12, PYR1-like 1 (.1) AT5G05440 160 / 8e-50 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT2G38310 151 / 5e-46 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT5G53160 147 / 1e-44 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT4G01026 146 / 3e-44 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT1G01360 144 / 1e-43 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024991 [exp] 392 / 3e-141 AT2G26040 264 / 7e-91 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10014239 [exp] 174 / 1e-54 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 175 / 2e-54 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10012231 [exp] 169 / 6e-53 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 159 / 6e-50 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10029222 [exp] 157 / 2e-48 AT2G40330 182 / 2e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10007275 [exp] 155 / 9e-48 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 145 / 8e-44 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10014929 [exp] 144 / 4e-43 AT5G53160 289 / 2e-100 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G230600 [exp] 271 / 2e-93 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.018G054400 [exp] 267 / 6e-92 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.001G142500 [exp] 207 / 2e-68 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.003G091700 [exp] 195 / 3e-63 AT4G17870 273 / 3e-94 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.006G104100 [exp] 181 / 1e-57 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.016G125400 [exp] 181 / 2e-57 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.008G073400 [exp] 161 / 5e-50 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 157 / 2e-48 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.002G169400 [exp] 150 / 8e-46 AT1G01360 305 / 2e-107 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) Potri.014G097100 [exp] 148 / 4e-45 AT1G01360 301 / 6e-106 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10026430 pacid=23176454 polypeptide=Lus10026430 locus=Lus10026430.g ID=Lus10026430.BGIv1.0 annot-version=v1.0 ATGGCAGGTAGCGGTACTAGCGGCGACGTCGTGCTACCAGAAGCGCTAATAGGTCGTGTAAGCCAAGAAGAATACAATGAGTTGAAGCCAATCATAGACA AATACCATAGCTTCGGGTCGGCCGCCTCCGACCCAAACACGTGCACCTCCTTGATGGCCCAGCGAGTTGAGGCACCTGCCACGGTTGTGTGGCCTCTGGT CCGTAGCTTTGATGCTCCTCAGAGGTACAAGCACTTTATCAAGAGTTGCAAACTCACAAGCGGCGACGGCGGTGTTGGCAGCGTCAGGGAGGTCACCGTT GTTTCAGGGCTTCCGGCCTCAACCAGCACTGAACGCCTGGAGATCCTTGACGACGAGAAGCGGGTGCTCAGCTTCCGAGTCTTGGGAGGACAGCACCGCC TTACAAACTACAGGTCTGTCACATCGGTCAACGAGTTGACAAACAACAAGAATAATAAGGTATACACGGTGGTTTTGGAGTCATACATGGTCGATATACC GGAGGCCAATACTGGGGAGGACACTAAGATGTTTGCTGACACTGTGGTTAAGCTCAACCTTCAGAAACTTGGATCCGCAGCTATGGCGGATCTCCACCAC CCACCTCCTACAGATCCCTGA
AA sequence Show only first row Show all	>Lus10026430 pacid=23176454 polypeptide=Lus10026430 locus=Lus10026430.g ID=Lus10026430.BGIv1.0 annot-version=v1.0 MAGSGTSGDVVLPEALIGRVSQEEYNELKPIIDKYHSFGSAASDPNTCTSLMAQRVEAPATVVWPLVRSFDAPQRYKHFIKSCKLTSGDGGVGSVREVTV VSGLPASTSTERLEILDDEKRVLSFRVLGGQHRLTNYRSVTSVNELTNNKNNKVYTVVLESYMVDIPEANTGEDTKMFADTVVKLNLQKLGSAAMADLHH PPPTDP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10026430 [exp]	0	1
AT1G78850			D-mannose binding lectin prote...		Lus10000579 [exp]	2.4	0.8981
AT3G53140			O-methyltransferase family pro...		Lus10023892 [exp]	4.7	0.9220
AT2G45670			calcineurin B subunit-related ...		Lus10036544 [exp]	7.3	0.8661
AT3G55770	LIM	WLIM2b	WLIM2b, GATA type zinc finger ...		Lus10034123 [exp]	8.5	0.8867
AT4G37030			unknown protein		Lus10011021 [exp]	9.2	0.8819
AT5G57850			D-aminoacid aminotransferase-l...		Lus10006441 [exp]	12.2	0.9018
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10040468 [exp]	15.2	0.8798
AT2G26040		RCAR14, PYL2	regulatory components of ABA r...		Lus10024991 [exp]	15.9	0.8248
AT5G17290		ATG5, APG5, ATA...	AUTOPHAGY 5, autophagy protein...		Lus10020737 [exp]	16.4	0.8615
AT5G28050			Cytidine/deoxycytidylate deami...		Lus10015942 [exp]	16.7	0.8712

Compare expression of checked genes

Lus10026430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.