Lus10026434 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002548 71 / 8e-15 ATCG01280 829 / 0.0 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Lus10007142 62 / 9e-13 ATCG01280 95 / 2e-23 Chloroplast Ycf2;ATPase, AAA type, core (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G170670 57 / 2e-11 ND /
PFAM info
Representative CDS sequence
>Lus10026434 pacid=23176453 polypeptide=Lus10026434 locus=Lus10026434.g ID=Lus10026434.BGIv1.0 annot-version=v1.0
ATGTTTAGCATAAGCGTCTCCTTACTCCTCCGCTTACGCCCAGAGTACGCTCACATTGTGTATCCGATCCAATTCTACAACGAAGGTCAGCTCGTAAGCC
CTCGTGGGAGCATTTATGATGAGATTTATGATGAAGAGGGTGATCTTCAAGAGAAGGTTGAAGAGGATGATCTTGATGACATTTATGAGAAATTTATGAA
GGGTGATCTTCAAGAGAATGATGAAGAGGATGAGCTTCAAGAGAATGATGAAGAGTTCTATAATCCTTTGTTTCATAGCTTTGGGTCCGCTATCCCGCGA
TTTTCCTACCCCCAAAGGGCCGGCCCTTTTTGGCCGGTTGTGGGCGAGGAGGGATTCGAACCCCCGACACCGTGGTTCGTAGCCACGTGCTCTAATCCTC
TGAGCTACAGGCCCCACCCCGTCTCCACTGGATCTGTTCCCGGAGTACCCTAA
AA sequence
>Lus10026434 pacid=23176453 polypeptide=Lus10026434 locus=Lus10026434.g ID=Lus10026434.BGIv1.0 annot-version=v1.0
MFSISVSLLLRLRPEYAHIVYPIQFYNEGQLVSPRGSIYDEIYDEEGDLQEKVEEDDLDDIYEKFMKGDLQENDEEDELQENDEEFYNPLFHSFGSAIPR
FSYPQRAGPFWPVVGEEGFEPPTPWFVATCSNPLSYRPHPVSTGSVPGVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026434 0 1
Lus10002716 1.0 0.9670
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Lus10004897 2.0 0.9568
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Lus10002548 3.0 0.9561
ATCG00670 PCLPP, ATCG0067... CASEINOLYTIC PROTEASE P 1, pla... Lus10006595 3.5 0.9444
Lus10007146 3.7 0.9070
AT4G34980 SLP2 subtilisin-like serine proteas... Lus10025048 7.7 0.9094
AT1G36160 GSD1, PAS3, GK,... PASTICCINO 3, GLOSSYHEAD 1, GU... Lus10024748 9.4 0.8842
ATCG00180 ATCG00180.1, RP... DNA-directed RNA polymerase fa... Lus10009499 12.3 0.9044
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Lus10013628 14.0 0.8736
Lus10004082 14.8 0.9175

Lus10026434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.