Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G53840 65 / 4e-14 ATPME1 pectin methylesterase 1 (.1) AT3G14300 64 / 1e-13 ATPMEPCRC, ATPME26 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) AT3G10710 46 / 2e-07 RHS12 root hair specific 12 (.1) AT5G04960 45 / 2e-07 Plant invertase/pectin methylesterase inhibitor superfamily (.1) AT3G62820 45 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G53370 42 / 6e-06 ATPMEPCRF pectin methylesterase PCR fragment F (.1) AT2G47670 37 / 0.0002 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G47670 37 / 0.0004 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G49220 36 / 0.0008 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037457 [exp] 124 / 1e-36 AT1G53840 234 / 1e-72 pectin methylesterase 1 (.1) Lus10003934 [exp] 122 / 2e-34 AT3G14300 663 / 0.0 A. THALIANA PECTIN METHYLESTERASE 26, pectinesterase family protein (.1) Lus10034859 [exp] 51 / 2e-09 AT3G10710 561 / 0.0 root hair specific 12 (.1) Lus10033399 [exp] 51 / 4e-09 AT3G10710 606 / 0.0 root hair specific 12 (.1) Lus10042193 [exp] 50 / 6e-09 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10008625 [exp] 49 / 2e-08 AT3G47670 146 / 8e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10037919 [exp] 40 / 3e-05 AT1G14890 137 / 3e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10020909 [exp] 40 / 3e-05 AT3G05610 547 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Lus10028910 [exp] 39 / 4e-05 AT1G62760 169 / 1e-51 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G072700 [exp] 71 / 3e-16 AT1G53840 723 / 0.0 pectin methylesterase 1 (.1) Potri.001G162700 [exp] 69 / 1e-15 AT1G53840 659 / 0.0 pectin methylesterase 1 (.1) Potri.001G108200 [exp] 51 / 2e-09 AT3G47670 122 / 1e-33 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.006G134800 [exp] 49 / 2e-08 AT1G53840 505 / 1e-173 pectin methylesterase 1 (.1) Potri.010G247600 [exp] 47 / 6e-08 AT3G10710 609 / 0.0 root hair specific 12 (.1) Potri.008G011200 [exp] 45 / 5e-07 AT3G10710 621 / 0.0 root hair specific 12 (.1) Potri.003G123500 [exp] 44 / 5e-07 AT3G47670 141 / 8e-41 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.005G022900 [exp] 42 / 7e-06 AT3G05610 593 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1) Potri.012G127400 [exp] 41 / 7e-06 AT4G25250 150 / 7e-46 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.015G128500 [exp] 41 / 9e-06 AT4G25250 144 / 2e-43 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10026435 pacid=23176443 polypeptide=Lus10026435 locus=Lus10026435.g ID=Lus10026435.BGIv1.0 annot-version=v1.0 ATGCTGTCTAAGGAGAGGATCGACGATCTGAAGACATGGCTGAGCACGGCGGTTACAGATCTGGACACTTGCCTCGACGCGATGCAGATGAACGAGACGG AGCACTCCGGATCGGAGGCGATTTTACATAAATTGGAGACGGCGATGAAGAATTCGACGGAATTCGTTAGCAACAGTCTTGCAATCGTGAACTGGTAA
AA sequence Show only first row Show all	>Lus10026435 pacid=23176443 polypeptide=Lus10026435 locus=Lus10026435.g ID=Lus10026435.BGIv1.0 annot-version=v1.0 MLSKERIDDLKTWLSTAVTDLDTCLDAMQMNETEHSGSEAILHKLETAMKNSTEFVSNSLAIVNW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G53840		ATPME1	pectin methylesterase 1 (.1)		Lus10026435 [exp]	0	1
AT4G16695			unknown protein		Lus10028968 [exp]	3.6	0.7817
AT3G10860			Cytochrome b-c1 complex, subun...		Lus10034442 [exp]	4.2	0.7761
AT3G13845			unknown protein		Lus10015617 [exp]	6.7	0.7744
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Lus10001986 [exp]	9.9	0.7424
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10026103 [exp]	10.2	0.7177
AT4G32530			ATPase, F0/V0 complex, subunit...		Lus10000347 [exp]	10.6	0.7511
AT1G12840		ATVHA-C, DET3	DE-ETIOLATED 3, ARABIDOPSIS TH...		Lus10031990 [exp]	10.6	0.7647
AT2G22795			unknown protein		Lus10007239 [exp]	20.0	0.7526
AT1G12390			Cornichon family protein (.1)		Lus10028906 [exp]	20.2	0.7468
AT5G59890		ADF4, ATADF4	actin depolymerizing factor 4 ...		Lus10024418 [exp]	20.6	0.7611

Compare expression of checked genes

Lus10026435 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.