Lus10026438 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026438 pacid=23176458 polypeptide=Lus10026438 locus=Lus10026438.g ID=Lus10026438.BGIv1.0 annot-version=v1.0
ATGCGCCGATTGAGTGTGGAGGCGACGGGCGTGGTTGACTTGTGGTTACGCCCGTGGGTGGATGTTGGTAATGAGCATGGTCGTGGTATTAATCAGGCCA
TGGGCGAGATTGGTCTTTCGTCACGGTCGTGCCTCCGGGAGCCGGAGATCAGGGCGGTGTTGGGATCGTGGTCGAGAGAGATCGATGGACAGTTTAGTGA
CCAATCTGCAAAGTCTAGAAAGCTAAGTGACATTTCTGTAGCTTCTGTAAAGTTCAAGGATTGA
AA sequence
>Lus10026438 pacid=23176458 polypeptide=Lus10026438 locus=Lus10026438.g ID=Lus10026438.BGIv1.0 annot-version=v1.0
MRRLSVEATGVVDLWLRPWVDVGNEHGRGINQAMGEIGLSSRSCLREPEIRAVLGSWSREIDGQFSDQSAKSRKLSDISVASVKFKD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026438 0 1
AT3G04620 DAN1 D NUCLDUO1-ACTIVATEEIC ACID BI... Lus10005531 1.0 0.9200
AT1G47710 Serine protease inhibitor (SER... Lus10009906 2.0 0.8252
Lus10011908 3.0 0.8095
AT2G26730 Leucine-rich repeat protein ki... Lus10002360 7.9 0.6987
AT1G19250 FMO1 flavin-dependent monooxygenase... Lus10005178 8.2 0.7622
Lus10020703 18.2 0.6820
AT1G79860 ATROPGEF12, ROP... MATERNAL EFFECT EMBRYO ARREST ... Lus10037866 21.7 0.7548
AT5G59190 subtilase family protein (.1) Lus10040254 23.5 0.7473
Lus10024141 25.4 0.7473
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 27.1 0.7473

Lus10026438 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.