Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028776 [exp] 44 / 2e-06 AT4G35785 127 / 5e-36 RNA-binding (RRM/RBD/RNP motifs) family protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G130301 [exp] 39 / 9e-05 AT4G35785 145 / 3e-43 RNA-binding (RRM/RBD/RNP motifs) family protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026442 pacid=23176411 polypeptide=Lus10026442 locus=Lus10026442.g ID=Lus10026442.BGIv1.0 annot-version=v1.0 ATGTTTCTTCTTCAAGTCCAGGCTAAAAGGTCTCGTGGCAGGGACCCGACTCCAGGCAGGTACCGAGGCGTGAAAGAGAATCAAGGGCGTGGTCATAGAC GCTCAAGAAGCGTCTCACCTCGTAGATGTGAAAGGAGAGATAGAGATGCTTTTCTCCCGTGTCAAGCGATGGAGTTTAAAGATAACGAGGAAGAAGGAGA ATGGACATGGGGAAGGTTAGGGGAGAGACTTAATTTGAGTACGTGCTGGGAAACGATCTCTAGACACGTTAGAAGTTTAATTTTATAA
AA sequence Show only first row Show all	>Lus10026442 pacid=23176411 polypeptide=Lus10026442 locus=Lus10026442.g ID=Lus10026442.BGIv1.0 annot-version=v1.0 MFLLQVQAKRSRGRDPTPGRYRGVKENQGRGHRRSRSVSPRRCERRDRDAFLPCQAMEFKDNEEEGEWTWGRLGERLNLSTCWETISRHVRSLIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026442 [exp]	0	1
AT4G24130			Protein of unknown function, D...		Lus10001674 [exp]	2.2	0.9142
AT3G57990			unknown protein		Lus10000401 [exp]	5.2	0.7715
					Lus10002344 [exp]	10.2	0.8287
AT5G16970		AT-AER	alkenal reductase (.1)		Lus10035274 [exp]	11.3	0.8512
AT1G11040			HSP40/DnaJ peptide-binding pro...		Lus10018152 [exp]	12.8	0.7300
AT4G10310		ATHKT1, HKT1	high-affinity K+ transporter 1...		Lus10030872 [exp]	17.1	0.8298
					Lus10016931 [exp]	21.2	0.7713
AT1G19630		CYP722A1	"cytochrome P450, family 722, ...		Lus10014285 [exp]	22.0	0.8362
AT2G26710		CYP72B1, CYP734...	PHYB ACTIVATION TAGGED SUPPRES...		Lus10036942 [exp]	22.4	0.8418
AT3G52160		KCS15	3-ketoacyl-CoA synthase 15 (.1...		Lus10000219 [exp]	25.4	0.8015

Compare expression of checked genes

Lus10026442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.