Lus10026449 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33090 147 / 8e-42 ATAPM1, APM1 aminopeptidase M1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025002 227 / 2e-70 AT4G33090 1196 / 0.0 aminopeptidase M1 (.1)
Lus10026448 167 / 8e-49 AT4G33090 1389 / 0.0 aminopeptidase M1 (.1)
Lus10025001 166 / 3e-48 AT4G33090 1385 / 0.0 aminopeptidase M1 (.1)
Lus10021792 43 / 3e-05 ND /
Lus10006165 43 / 3e-05 AT5G45260 66 / 5e-12 SENSITIVE TO LOW HUMIDITY 1, RESISTANT TO RALSTONIA SOLANACEARUM 1, ARABIDOPSIS THALIANA WRKY DOMAIN PROTEIN 52, Disease resistance protein (TIR-NBS-LRR class) (.1), Disease resistance protein (TIR-NBS-LRR class) (.2)
Lus10008761 42 / 5e-05 AT2G25010 79 / 1e-15 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10014633 41 / 6e-05 AT2G04865 61 / 2e-11 Aminotransferase-like, plant mobile domain family protein (.1)
Lus10022091 42 / 0.0001 AT3G23070 860 / 0.0 CRM family member 3A (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G224500 171 / 3e-50 AT4G33090 1356 / 0.0 aminopeptidase M1 (.1)
Potri.017G039200 123 / 3e-33 AT4G33090 1102 / 0.0 aminopeptidase M1 (.1)
PFAM info
Representative CDS sequence
>Lus10026449 pacid=23176440 polypeptide=Lus10026449 locus=Lus10026449.g ID=Lus10026449.BGIv1.0 annot-version=v1.0
ATGAAGACCATGTATACATCCGCATCCCCTAAACCGTTCCCCAAGGCTACCGTCGACTTCTCATGGATCGCAACACCTTCAACCAATGGTGCTCTGGCTT
CCTGTCCGGATCCAAGAATAGTTCTTCAAGCTCTAAAATTTTTGTTGACTCCCGAGGCTCGAACTCAAGATGCTGCTTTAGGTCTTGCTATCTCTAAAGA
AGGACGTGAAACTGCTTGGAAATGGTTCAAGGTTAACTGGGATCACATCTGGCAAACATGGGGTTCTGGATCTTTAACTAACCGTTTCATCAAAGGAATT
GTCTCCCCGTTTGATTCCTTTGAGATGTGCAAGGAAGTGGAGGACTTCTTTGAGAGCCGCACAACGGATTCAATATCTAGAACAGTGAAGCAAAGCATTG
AGCGAGTCAAGATTAATGCCATGTGGGTTGACAGCATTTGA
AA sequence
>Lus10026449 pacid=23176440 polypeptide=Lus10026449 locus=Lus10026449.g ID=Lus10026449.BGIv1.0 annot-version=v1.0
MKTMYTSASPKPFPKATVDFSWIATPSTNGALASCPDPRIVLQALKFLLTPEARTQDAALGLAISKEGRETAWKWFKVNWDHIWQTWGSGSLTNRFIKGI
VSPFDSFEMCKEVEDFFESRTTDSISRTVKQSIERVKINAMWVDSI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33090 ATAPM1, APM1 aminopeptidase M1 (.1) Lus10026449 0 1

Lus10026449 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.