Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51770 62 / 4e-12 ATEOL1, ETO1 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) AT5G58550 47 / 9e-07 EOL2 ETO1-like 2 (.1.2) AT4G02680 40 / 0.0003 EOL1 ETO1-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012474 [exp] 85 / 1e-21 AT1G27060 89 / 2e-21 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10038724 [exp] 87 / 7e-21 AT5G11580 629 / 0.0 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10024239 [exp] 85 / 9e-21 AT1G26930 147 / 3e-41 Galactose oxidase/kelch repeat superfamily protein (.1) Lus10008730 [exp] 82 / 6e-20 AT1G27060 132 / 1e-36 Regulator of chromosome condensation (RCC1) family protein (.1) Lus10012472 [exp] 56 / 2e-10 AT3G51770 230 / 2e-70 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10022660 [exp] 56 / 5e-10 AT3G51770 1231 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031859 [exp] 48 / 3e-07 AT3G51770 1088 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10031289 [exp] 48 / 3e-07 AT3G51770 1083 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Lus10010040 [exp] 45 / 7e-07 AT3G51770 165 / 3e-48 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G075300 [exp] 70 / 6e-15 AT3G51770 1206 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.001G280100 [exp] 66 / 2e-13 AT3G51770 1192 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.016G123800 [exp] 66 / 2e-13 AT3G51770 1415 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2) Potri.006G103400 [exp] 65 / 3e-13 AT3G51770 1399 / 0.0 ARABIDOPSIS ETHYLENE OVERPRODUCER 1, tetratricopeptide repeat (TPR)-containing protein (.1), tetratricopeptide repeat (TPR)-containing protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026455 pacid=23176429 polypeptide=Lus10026455 locus=Lus10026455.g ID=Lus10026455.BGIv1.0 annot-version=v1.0 ATGGAGGATGAGCTCCTCCGTCCTCCGCTGCTTACGGCCGCCAGACTAATCTCCATGCTCGCTTGCAGTGGAGCTCACGCATGTGTTATGGCCTCCACCA GTAAGGATTCCAAGGAACAACAGCTCGGTGATGTTAATGAAAAGGATGAAGTTGGAGACGAGGGTTCTGATGTTGACAAAAGACTATCAGCTGCAATGGA GGAGAATAAGCTTCTCCGATCAAAATATTCCAAGGCGGAGAAATCCAGACTCTGTCTGGAACAATCCGTCGTGCTTCACGGGCTACCTGACCCGAAGATG CTCCGGCAGAGCATCTGTTTGGCTCGGCAGCACGCCGTCGACGTCCACTCCAAAATCGTGCTCGCTTCCTGGCTGTGA
AA sequence Show only first row Show all	>Lus10026455 pacid=23176429 polypeptide=Lus10026455 locus=Lus10026455.g ID=Lus10026455.BGIv1.0 annot-version=v1.0 MEDELLRPPLLTAARLISMLACSGAHACVMASTSKDSKEQQLGDVNEKDEVGDEGSDVDKRLSAAMEENKLLRSKYSKAEKSRLCLEQSVVLHGLPDPKM LRQSICLARQHAVDVHSKIVLASWL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10026455 [exp]	0	1
AT2G20990		SYT1, NTMC2TYPE...	SYNAPTOTAGMIN 1, ARABIDOPSIS T...		Lus10027842 [exp]	1.4	0.8695
AT2G32360			Ubiquitin-like superfamily pro...		Lus10027183 [exp]	8.6	0.6650
AT5G58610			PHD finger transcription facto...		Lus10015250 [exp]	9.5	0.7470
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	12.4	0.7603
AT2G28470		BGAL8	beta-galactosidase 8 (.1.2)		Lus10036108 [exp]	12.4	0.7080
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	15.2	0.7603
AT3G28630			Protein of unknown function (D...		Lus10001124 [exp]	17.1	0.7185
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	17.5	0.7603
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	19.6	0.7603
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	21.5	0.7603

Compare expression of checked genes

Lus10026455 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.