Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G06520 47 / 1e-07 PSBX photosystem II subunit X (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025007 [exp] 120 / 2e-36 AT2G06520 72 / 3e-17 photosystem II subunit X (.1) Lus10033434 [exp] 68 / 9e-16 AT2G06520 93 / 1e-25 photosystem II subunit X (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G065200 [exp] 66 / 7e-15 AT2G06520 100 / 1e-28 photosystem II subunit X (.1) Potri.006G222300 [exp] 64 / 2e-14 AT2G06520 80 / 2e-20 photosystem II subunit X (.1) Potri.006G144000 [exp] 64 / 5e-14 AT2G06520 97 / 6e-27 photosystem II subunit X (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06596 [flax] [poplar] PsbX Photosystem II reaction centre X protein (PsbX)
Representative CDS sequence Show only first row Show all	>Lus10026458 pacid=23176410 polypeptide=Lus10026458 locus=Lus10026458.g ID=Lus10026458.BGIv1.0 annot-version=v1.0 ATGGCGACAGTGTCAATGCCGGGTATGCCACTGATGACTTCAGGGCCAGCAAAAGCAGAGAGGAGGTCTGCGGTGAAATCTTTCTCCTCAAAAGCAGGTG CTTACAGTTCGAGAAGCAGCGGCCGACGGTCATTCCGAGTGGAGGCGTCGCTGAAAGAGAGGGTTTTGGGAGGCGTAAGTGCGGCGGCAGTAGCAGCTTC GATGGTGGTTCCAGATGTGGCAGTAGCAGCAGAATACACCCTAACACCATCTCTCAAGAACTTCTTGCTGAGCATTGCTGCTGGTACTTTCGTCCTTAGC GCTATTGCTGGTGCTATTATTGGCGTCTCCAACTTCGACCCTGTCAAGCGGGCCTGA
AA sequence Show only first row Show all	>Lus10026458 pacid=23176410 polypeptide=Lus10026458 locus=Lus10026458.g ID=Lus10026458.BGIv1.0 annot-version=v1.0 MATVSMPGMPLMTSGPAKAERRSAVKSFSSKAGAYSSRSSGRRSFRVEASLKERVLGGVSAAAVAASMVVPDVAVAAEYTLTPSLKNFLLSIAAGTFVLS AIAGAIIGVSNFDPVKRA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10026458 [exp]	0	1
AT2G06520		PSBX	photosystem II subunit X (.1)		Lus10025007 [exp]	1.0	0.9811
AT1G60950		FED A, ATFD2, F...	FERREDOXIN 2, 2Fe-2S ferredoxi...		Lus10001369 [exp]	7.3	0.9315
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10026205 [exp]	7.5	0.9442
AT5G52010	C2H2ZnF		C2H2-like zinc finger protein ...		Lus10018728 [exp]	7.5	0.8848
AT1G79040		PSBR	photosystem II subunit R (.1)		Lus10042461 [exp]	9.8	0.9362
AT4G05180		PSII-Q, PSBQ, P...	photosystem II subunit Q-2 (.1...		Lus10018385 [exp]	10.2	0.9390
AT5G40500			unknown protein		Lus10022273 [exp]	11.0	0.8598
AT1G51400			Photosystem II 5 kD protein (....		Lus10030132 [exp]	13.0	0.9213
AT1G30380		PSAK	photosystem I subunit K (.1)		Lus10012086 [exp]	14.0	0.9350
AT1G15820		CP24, LHCB6	light harvesting complex photo...		Lus10015831 [exp]	15.0	0.9195

Compare expression of checked genes

Lus10026458 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.