Lus10026470 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006817 69 / 2e-14 AT4G39400 1356 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1)
Lus10005784 67 / 9e-14 AT4G39400 1361 / 0.0 DWARF 2, CABBAGE 2, BRASSINOSTEROID INSENSITIVE 1, BR INSENSITIVE 1, Leucine-rich receptor-like protein kinase family protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026470 pacid=23176451 polypeptide=Lus10026470 locus=Lus10026470.g ID=Lus10026470.BGIv1.0 annot-version=v1.0
ATGTGGTTAATTCCTCTAAACTGGACGTTGAATGCATATGTGCCGCGTAGAAACTGGGAACTCGTCGGTGACTTGTTGACGGAAAGGTCAAAGGTATCCA
AGGACGATGAACAAGAAGTAAACCCGAGAGAAATCGAACCAGTGAGATTGTTTGAAGATAGATCGAGATTCGCACAAGATCTGGAGATAAATCGTCGACG
AGACTCGCCGTGGAATTGGTTGCCGAATAGCAACAAGAACTTCAACTTCTTCTTCCACAGATGGTGGGGTTTCACCGGAAACGTTAGAAAACGCGAGACT
CTTGCATCATTGGAGAAGAGTGCCAAGATCGCCGAAGAATTTGTTGTGGAAGACGTCGAGGTGGGAGAGAGATGGAAGAGGAAGAGAGGATACACATGA
AA sequence
>Lus10026470 pacid=23176451 polypeptide=Lus10026470 locus=Lus10026470.g ID=Lus10026470.BGIv1.0 annot-version=v1.0
MWLIPLNWTLNAYVPRRNWELVGDLLTERSKVSKDDEQEVNPREIEPVRLFEDRSRFAQDLEINRRRDSPWNWLPNSNKNFNFFFHRWWGFTGNVRKRET
LASLEKSAKIAEEFVVEDVEVGERWKRKRGYT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026470 0 1
AT2G16190 unknown protein Lus10040480 3.5 0.6979
AT3G57170 N-acetylglucosaminyl transfera... Lus10003248 6.8 0.7420
AT1G32400 TOM2A tobamovirus multiplication 2A ... Lus10040108 11.0 0.7281
AT1G77260 S-adenosyl-L-methionine-depend... Lus10042762 13.0 0.6794
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10022663 16.0 0.6955
AT5G36930 Disease resistance protein (TI... Lus10042714 16.2 0.6781
AT3G43790 ZIFL2 zinc induced facilitator-like ... Lus10041286 31.1 0.6122
AT1G68800 TCP TCP12, BRC2, TC... BRANCHED 2, TCP domain protein... Lus10032465 33.0 0.6610
Lus10013898 38.5 0.6453
AT2G26150 HSF ATHSFA2 heat shock transcription facto... Lus10027627 43.3 0.6388

Lus10026470 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.