Lus10026489 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03080 292 / 8e-101 Phosphatidic acid phosphatase (PAP2) family protein (.1)
AT3G50920 40 / 0.0005 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019919 303 / 1e-105 AT5G03080 238 / 2e-80 Phosphatidic acid phosphatase (PAP2) family protein (.1)
Lus10028327 56 / 6e-09 AT3G50920 156 / 2e-46 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Lus10028326 46 / 7e-06 AT5G66450 160 / 2e-48 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Lus10028328 46 / 7e-06 AT5G66450 232 / 2e-76 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Lus10041774 46 / 1e-05 AT5G66450 229 / 3e-75 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Lus10041773 41 / 0.0003 AT3G50920 101 / 7e-30 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G130700 315 / 4e-110 AT5G03080 313 / 2e-109 Phosphatidic acid phosphatase (PAP2) family protein (.1)
Potri.016G086700 291 / 1e-100 AT5G03080 297 / 4e-103 Phosphatidic acid phosphatase (PAP2) family protein (.1)
Potri.005G120400 53 / 2e-08 AT5G66450 219 / 9e-71 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
Potri.007G021600 51 / 1e-07 AT5G66450 240 / 1e-78 Phosphatidic acid phosphatase (PAP2) family protein (.1), Phosphatidic acid phosphatase (PAP2) family protein (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0525 pap2 PF01569 PAP2 PAP2 superfamily
Representative CDS sequence
>Lus10026489 pacid=23164419 polypeptide=Lus10026489 locus=Lus10026489.g ID=Lus10026489.BGIv1.0 annot-version=v1.0
ATGCCGCCATTGAAGGCCGTTACCCTCACCCACGTCCGGTACCAGAGAGGCGACCAATTAGGCCATTTCCTCGCCTGGATCTCACTCGTCCCGGTCTTCA
TCAGCTTCGGCGGATTCGTCTCCCATTTCATCTTCCGCCGCGAGCTCCAGGCCATGTTCTTCGCCCTAGGCCTCCTCATCTCCCAATTCGTCAACGAAGT
CGTCAAGAACACCTTCCAGCAGGCCCGCCCCATCACCTGCGAGCTCCTCGAGATGTGCGATTCCCACGGCTGGCCCTCCAGCCACTCCCAGTACATGTTC
TTCTTCGCCACCTATTTCACCATGCTCATGGTCAAAGGGATCGGCCTCGCCGAGTCGATTCGGAACAAGGCGCTCGCGTTTTACCTGGCCTGGTCTATGG
CGGCACTTACGATGTACTCGCGGGTGTATTTAGGGTACCACACGGTGGCGCAGGTGTTCGCCGGGGCTACATTGGGGCTTTTCCTCGGCGGGGTGTGGTT
CTGGGTGGTGAACTCGGTGCTTATCATCTACTTTCCGGCGATCGAGGAGAGTAGATTAGGGAGGATGTTCTATGTGAAGGATACCTCCCATATACGCAAT
GTGTTGCAGTTTGAGTATGATAATGCCAGAGCTGCTAGGACGAATATGGCTGCTAGGAAGGTTATGGATCCCAAGACAATCTGA
AA sequence
>Lus10026489 pacid=23164419 polypeptide=Lus10026489 locus=Lus10026489.g ID=Lus10026489.BGIv1.0 annot-version=v1.0
MPPLKAVTLTHVRYQRGDQLGHFLAWISLVPVFISFGGFVSHFIFRRELQAMFFALGLLISQFVNEVVKNTFQQARPITCELLEMCDSHGWPSSHSQYMF
FFATYFTMLMVKGIGLAESIRNKALAFYLAWSMAALTMYSRVYLGYHTVAQVFAGATLGLFLGGVWFWVVNSVLIIYFPAIEESRLGRMFYVKDTSHIRN
VLQFEYDNARAARTNMAARKVMDPKTI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03080 Phosphatidic acid phosphatase ... Lus10026489 0 1
AT5G03080 Phosphatidic acid phosphatase ... Lus10019919 1.4 0.9612
AT5G67020 unknown protein Lus10019345 1.4 0.9349
AT1G28680 HXXXD-type acyl-transferase fa... Lus10015303 4.5 0.9210
AT1G75390 bZIP ATBZIP44 basic leucine-zipper 44 (.1.2) Lus10040428 5.5 0.9268
AT2G36300 Integral membrane Yip1 family ... Lus10021374 6.5 0.9206
AT3G62660 GATL7 galacturonosyltransferase-like... Lus10002440 8.5 0.9115
AT1G79550 PGK phosphoglycerate kinase (.1.2) Lus10031743 9.4 0.9150
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10014234 11.3 0.9232
AT3G52760 Integral membrane Yip1 family ... Lus10017054 13.9 0.9196
AT5G11730 Core-2/I-branching beta-1,6-N-... Lus10005505 14.7 0.8846

Lus10026489 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.