Lus10026491 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10019921 71 / 7e-18 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026491 pacid=23164307 polypeptide=Lus10026491 locus=Lus10026491.g ID=Lus10026491.BGIv1.0 annot-version=v1.0
ATGGAGCTCAGAAATCTTTCTCCTCCCAGTACTCCCAAAGTAGCCGCTTTGCTTATCATTACGTCTCTTCTTCTCCTCACTTTTGCTGTTTCCTCTTCCT
CTGCCACCGTCACAGATGAACCGATGAAGCCGGCGGCGGTGGCTGAGGCAGAGTACGATGTAGACTACAGGGGACCGGAGACTCACCCAGCCGATTTCCC
ACCGGCGCCGACCGGTCATCATTTAGGGGCAGGACACCTTTCCACCCCGCCGATTTTTGGTTGGGATTGA
AA sequence
>Lus10026491 pacid=23164307 polypeptide=Lus10026491 locus=Lus10026491.g ID=Lus10026491.BGIv1.0 annot-version=v1.0
MELRNLSPPSTPKVAALLIITSLLLLTFAVSSSSATVTDEPMKPAAVAEAEYDVDYRGPETHPADFPPAPTGHHLGAGHLSTPPIFGWD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026491 0 1
AT4G02780 ATCPS1, ABC33, ... GA REQUIRING 1, CPP synthase, ... Lus10004323 2.4 0.7781
AT3G07880 SCN1 SUPERCENTIPEDE1, Immunoglobuli... Lus10027327 5.7 0.7414
AT4G28365 AtENODL3 early nodulin-like protein 3 (... Lus10018617 6.3 0.7414
AT1G05675 UDP-Glycosyltransferase superf... Lus10010469 6.6 0.7277
Lus10016118 7.4 0.7277
AT5G39300 ATHEXPALPHA1.18... EXPANSIN 25, expansin A25 (.1) Lus10000305 8.4 0.6796
AT5G17540 HXXXD-type acyl-transferase fa... Lus10005660 12.0 0.6504
AT3G51240 TT6, F3'H, F3H TRANSPARENT TESTA 6, flavanone... Lus10041913 13.4 0.6948
AT5G17200 Pectin lyase-like superfamily ... Lus10014826 18.0 0.6476
AT2G16730 BGAL13 beta-galactosidase 13, glycosy... Lus10027843 22.8 0.6662

Lus10026491 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.