Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37195 123 / 3e-37 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023187 [exp] 226 / 2e-77 AT2G37195 129 / 5e-39 unknown protein Lus10002229 [exp] 221 / 3e-76 AT2G37195 132 / 1e-40 unknown protein Lus10019937 [exp] 191 / 1e-63 AT2G37195 103 / 1e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G090000 [exp] 210 / 9e-72 AT2G37195 132 / 8e-41 unknown protein Potri.006G127800 [exp] 209 / 3e-71 AT2G37195 134 / 1e-41 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026508 pacid=23164277 polypeptide=Lus10026508 locus=Lus10026508.g ID=Lus10026508.BGIv1.0 annot-version=v1.0 ATGGCCGGCGAAAGAAGGAAGATTTTGGTGGGTCTGGTCGCGGCAATGCTTCTGGGGACTGCAGTTTACTTCAGGCTTTGGTCCATTGACTACGCTATTT CCTCCGACGACACTGACCTCATAAGAAGGCAATTCGACTTGGCCAATCGAGAAGCTATGGATGAATCCGCGGAGTGGAGGATGAAGTATGATGAGGAGGC AGAGAGAGCAGCCAAGTGTGACAAGGAAATCATAGAGATCAAGCAGAAGGTGGACGATGCTGCAAGTGTCAACCAACAGTTGCTGGTGCTACAGAAGGAA AACATGGCACTGATCGGAAGAATGGAAGCACTGAGAAAGGAGCTGGTAGTTGCCAAGTCAAAGTGTCGCTCGAGATAG
AA sequence Show only first row Show all	>Lus10026508 pacid=23164277 polypeptide=Lus10026508 locus=Lus10026508.g ID=Lus10026508.BGIv1.0 annot-version=v1.0 MAGERRKILVGLVAAMLLGTAVYFRLWSIDYAISSDDTDLIRRQFDLANREAMDESAEWRMKYDEEAERAAKCDKEIIEIKQKVDDAASVNQQLLVLQKE NMALIGRMEALRKELVVAKSKCRSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37195			unknown protein		Lus10026508 [exp]	0	1
AT4G02600		MLO1, ATMLO1	MILDEW RESISTANCE LOCUS O 1, S...		Lus10027093 [exp]	1.0	0.9179
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10025797 [exp]	3.2	0.8610
AT1G17100			SOUL heme-binding family prote...		Lus10029117 [exp]	6.5	0.8242
AT4G23740			Leucine-rich repeat protein ki...		Lus10039321 [exp]	9.9	0.8734
AT1G16470		PAB1	proteasome subunit PAB1 (.1.2)		Lus10036210 [exp]	14.7	0.8609
AT3G14410			Nucleotide/sugar transporter f...		Lus10016923 [exp]	14.9	0.8446
AT3G07880		SCN1	SUPERCENTIPEDE1, Immunoglobuli...		Lus10002272 [exp]	15.3	0.8431
AT4G21585		ENDO4	endonuclease 4 (.1)		Lus10018451 [exp]	15.6	0.8531
AT4G28360			Ribosomal protein L22p/L17e fa...		Lus10037603 [exp]	16.7	0.8705
AT5G07040			RING/U-box superfamily protein...		Lus10005389 [exp]	18.1	0.8118

Compare expression of checked genes

Lus10026508 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.