Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37030 139 / 6e-44 SAUR-like auxin-responsive protein family (.1) AT3G53250 104 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT5G03310 104 / 3e-30 SAUR-like auxin-responsive protein family (.1) AT4G34760 73 / 1e-17 SAUR-like auxin-responsive protein family (.1) AT5G66260 72 / 1e-17 SAUR-like auxin-responsive protein family (.1) AT4G34800 72 / 2e-17 SAUR-like auxin-responsive protein family (.1) AT4G34810 72 / 2e-17 SAUR-like auxin-responsive protein family (.1) AT3G43120 73 / 3e-17 SAUR-like auxin-responsive protein family (.1) AT4G34770 71 / 8e-17 SAUR-like auxin-responsive protein family (.1) AT5G20810 72 / 1e-16 SAUR-like auxin-responsive protein family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013808 [exp] 240 / 1e-83 AT2G37030 141 / 1e-44 SAUR-like auxin-responsive protein family (.1) Lus10037990 [exp] 81 / 8e-21 AT5G03310 77 / 8e-20 SAUR-like auxin-responsive protein family (.1) Lus10034507 [exp] 77 / 5e-19 AT1G75590 189 / 1e-62 SAUR-like auxin-responsive protein family (.1) Lus10028466 [exp] 74 / 4e-18 AT4G34760 151 / 5e-49 SAUR-like auxin-responsive protein family (.1) Lus10009219 [exp] 74 / 5e-18 AT3G53250 70 / 7e-17 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 73 / 5e-18 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10033161 [exp] 75 / 6e-18 AT1G75590 187 / 4e-62 SAUR-like auxin-responsive protein family (.1) Lus10042376 [exp] 73 / 7e-18 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 73 / 7e-18 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G091500 [exp] 147 / 5e-47 AT2G37030 136 / 2e-42 SAUR-like auxin-responsive protein family (.1) Potri.006G126500 [exp] 141 / 9e-45 AT2G37030 131 / 1e-40 SAUR-like auxin-responsive protein family (.1) Potri.008G037900 [exp] 100 / 2e-28 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G224500 [exp] 100 / 3e-28 AT2G37030 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.002G024500 [exp] 76 / 2e-18 AT1G75590 194 / 1e-64 SAUR-like auxin-responsive protein family (.1) Potri.002G024300 [exp] 72 / 1e-17 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 72 / 1e-17 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.004G165900 [exp] 71 / 2e-17 AT4G34770 99 / 9e-29 SAUR-like auxin-responsive protein family (.1) Potri.005G237000 [exp] 72 / 3e-17 AT1G75590 200 / 4e-67 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 71 / 5e-17 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10026521 pacid=23164253 polypeptide=Lus10026521 locus=Lus10026521.g ID=Lus10026521.BGIv1.0 annot-version=v1.0 ATGAAGGGGAAGTTTGTGAAGACATGCATGAACAAGTGGAGAAGGATGGGGAGCAAAGTCATACCTTGTGCAGGCTGCGAGTATTGCTGCAAAGAATTGG GGTTGTGGGCTGAATCCAAGTCAATTCCTAAAGATGTTCCAAAGGGTCATTTAGTAGTGTATGTAGGAGAAGAATACAAGAGGTTTGTGATCAAGATTAC CTTGCTGGAGCACCCCCTGTTCAAGGCATTGCTGGAACGGGCTAAGGATGAGTATGACTTCACTTTCGCCGACTCCAAGCTTTGCATCCCTTGTGATGAG AAGATGTTCCTGGATGTACTTCGCTGCGCAGACCACGGAAGAAGTTCCCTGTGTCTTTGA
AA sequence Show only first row Show all	>Lus10026521 pacid=23164253 polypeptide=Lus10026521 locus=Lus10026521.g ID=Lus10026521.BGIv1.0 annot-version=v1.0 MKGKFVKTCMNKWRRMGSKVIPCAGCEYCCKELGLWAESKSIPKDVPKGHLVVYVGEEYKRFVIKITLLEHPLFKALLERAKDEYDFTFADSKLCIPCDE KMFLDVLRCADHGRSSLCL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37030			SAUR-like auxin-responsive pro...		Lus10026521 [exp]	0	1
AT2G37030			SAUR-like auxin-responsive pro...		Lus10013808 [exp]	1.0	0.9696
AT4G26400			RING/U-box superfamily protein...		Lus10043027 [exp]	9.6	0.9496
AT4G21620			glycine-rich protein (.1.2)		Lus10011230 [exp]	11.8	0.8956
AT5G03860		MLS	malate synthase (.1.2)		Lus10020565 [exp]	14.7	0.9379
					Lus10005025 [exp]	14.8	0.8827
AT5G50770		ATHSD6	hydroxysteroid dehydrogenase 6...		Lus10022441 [exp]	16.1	0.9306
AT1G12780		ATUGE1, UGE1	A. THALIANA UDP-GLC 4-EPIMERAS...		Lus10029572 [exp]	17.7	0.9405
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10013674 [exp]	18.3	0.9221
AT3G26510			Octicosapeptide/Phox/Bem1p fam...		Lus10026700 [exp]	19.0	0.9253
AT3G11340		UGT76B1	UDP-dependent glycosyltransfer...		Lus10004672 [exp]	21.9	0.9157

Compare expression of checked genes

Lus10026521 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.