Lus10026523 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09830 152 / 4e-45 Protein kinase superfamily protein (.1.2)
AT5G03320 137 / 1e-39 Protein kinase superfamily protein (.1)
AT2G28940 72 / 1e-15 Protein kinase superfamily protein (.1.2)
AT1G69790 64 / 1e-12 Protein kinase superfamily protein (.1)
AT5G02290 64 / 2e-12 NAK Protein kinase superfamily protein (.1.2)
AT1G14370 64 / 2e-12 Kin1, PBL2, APK2A PBS1-like 2, kinase 1, protein kinase 2A (.1)
AT1G07570 63 / 3e-12 APK1A Protein kinase superfamily protein (.1.2.3)
AT2G28930 62 / 8e-12 APK1B protein kinase 1B (.1.2.3)
AT2G26290 60 / 3e-11 ARSK1 root-specific kinase 1 (.1)
AT5G15080 59 / 4e-11 Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013811 254 / 2e-88 AT3G09830 145 / 9e-43 Protein kinase superfamily protein (.1.2)
Lus10038711 115 / 4e-31 AT3G09830 547 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10037980 108 / 2e-28 AT3G09830 544 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10016536 67 / 1e-13 AT2G28940 576 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10021489 62 / 5e-12 AT2G02800 459 / 3e-161 protein kinase 2B (.1.2)
Lus10030668 62 / 8e-12 AT5G15080 723 / 0.0 Protein kinase superfamily protein (.1)
Lus10005255 62 / 9e-12 AT5G15080 720 / 0.0 Protein kinase superfamily protein (.1)
Lus10040804 61 / 1e-11 AT2G28940 578 / 0.0 Protein kinase superfamily protein (.1.2)
Lus10022591 61 / 2e-11 AT2G02800 462 / 2e-162 protein kinase 2B (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G126000 187 / 3e-58 AT3G09830 587 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.008G036800 135 / 2e-38 AT3G09830 537 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.010G225300 127 / 1e-35 AT2G39110 538 / 0.0 Protein kinase superfamily protein (.1)
Potri.009G031500 87 / 6e-21 AT2G28940 565 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.001G240500 87 / 9e-21 AT2G28940 563 / 0.0 Protein kinase superfamily protein (.1.2)
Potri.006G072200 66 / 3e-13 AT2G17220 391 / 2e-134 kinase 3, Protein kinase superfamily protein (.1.2)
Potri.014G052700 63 / 2e-12 AT5G47070 431 / 2e-149 Protein kinase superfamily protein (.1)
Potri.010G203400 63 / 2e-12 AT2G28930 540 / 0.0 protein kinase 1B (.1.2.3)
Potri.008G056400 63 / 3e-12 AT1G07570 528 / 0.0 Protein kinase superfamily protein (.1.2.3)
Potri.017G077300 61 / 1e-11 AT5G15080 690 / 0.0 Protein kinase superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026523 pacid=23164282 polypeptide=Lus10026523 locus=Lus10026523.g ID=Lus10026523.BGIv1.0 annot-version=v1.0
ATGAAGTGCTTTCACTTCTATATCGGAGAAAGGAAGGGTGATCTAAGGACAACAAAGTCTACATCAGTTACATCATTGTACTCGAATTTTACTGATCGTG
AAATGGGGAGATCGGGGTCAGAGTTGAATTCTCAAAATGTCTCAGCCACCAGTGTAGAATCAATGGGGAGGCCTAGCTACCCTAGTCTGTCCCAGAGACC
AAGCAATCTGAGATCTTTCACTGTTTCTGAACTTAAGGCCGCCACCAGGAACTTCAGTCGCTCTGTCATGGTTGGAGAGGGTGGATTTGGATGCGTCTAC
AGGGGATCAATAAAGAGTGCGGAGGAGCCTCTCAAAAAGATTGAAGTCGCTGTGAAACAGCTTGGTAAAAGGGGAACTCAGGCAAGTCTTTCCCCTCTAG
GCAGTCCTCTATCTTCATTTAGTAGTTACTAA
AA sequence
>Lus10026523 pacid=23164282 polypeptide=Lus10026523 locus=Lus10026523.g ID=Lus10026523.BGIv1.0 annot-version=v1.0
MKCFHFYIGERKGDLRTTKSTSVTSLYSNFTDREMGRSGSELNSQNVSATSVESMGRPSYPSLSQRPSNLRSFTVSELKAATRNFSRSVMVGEGGFGCVY
RGSIKSAEEPLKKIEVAVKQLGKRGTQASLSPLGSPLSSFSSY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09830 Protein kinase superfamily pro... Lus10026523 0 1
AT1G03080 kinase interacting (KIP1-like)... Lus10006896 3.6 0.7830
AT2G17480 ATMLO8, MLO8 MILDEW RESISTANCE LOCUS O 8, S... Lus10022096 3.9 0.7324
AT3G10660 ATCPK2, CPK2 calmodulin-domain protein kina... Lus10021248 5.5 0.6957
AT3G23280 XBAT35 XB3 ortholog 5 in Arabidopsis ... Lus10009674 7.2 0.7776
AT2G30580 BMI1A, DRIP2 DREB2A-interacting protein 2 (... Lus10003261 19.2 0.6965
AT1G09970 RLK7, LRRXI-23 ... receptor-like kinase 7, Leucin... Lus10028232 23.5 0.6756
AT4G00710 BSK3 BR-signaling kinase 3 (.1) Lus10018849 25.9 0.6288
AT5G35410 ATSOS2, CIPK24,... SNF1-RELATED PROTEIN KINASE 3.... Lus10043267 26.3 0.6519
AT3G09830 Protein kinase superfamily pro... Lus10013811 27.7 0.6812
AT5G42080 RSW9, DRP1A, AG... RADIAL SWELLING 9, DYNAMIN-REL... Lus10023073 27.9 0.7095

Lus10026523 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.