Lus10026525 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G03330 272 / 2e-89 Cysteine proteinases superfamily protein (.1.2)
AT5G04250 238 / 2e-76 Cysteine proteinases superfamily protein (.1.2)
AT3G02070 223 / 4e-72 Cysteine proteinases superfamily protein (.1)
AT3G22260 210 / 7e-67 Cysteine proteinases superfamily protein (.1.2.3)
AT2G39320 107 / 1e-27 Cysteine proteinases superfamily protein (.1)
AT5G67170 70 / 4e-13 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
AT2G27350 54 / 6e-08 OTLD1 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013813 619 / 0 AT5G03330 280 / 2e-92 Cysteine proteinases superfamily protein (.1.2)
Lus10023019 365 / 4e-126 AT5G03330 325 / 4e-110 Cysteine proteinases superfamily protein (.1.2)
Lus10001404 362 / 1e-124 AT5G03330 327 / 9e-111 Cysteine proteinases superfamily protein (.1.2)
Lus10038708 256 / 9e-83 AT5G04250 367 / 2e-126 Cysteine proteinases superfamily protein (.1.2)
Lus10037977 249 / 3e-80 AT5G04250 361 / 5e-124 Cysteine proteinases superfamily protein (.1.2)
Lus10037388 236 / 1e-75 AT5G04250 239 / 6e-77 Cysteine proteinases superfamily protein (.1.2)
Lus10027312 211 / 3e-66 AT3G22260 303 / 3e-104 Cysteine proteinases superfamily protein (.1.2.3)
Lus10010459 208 / 5e-66 AT3G22260 338 / 7e-119 Cysteine proteinases superfamily protein (.1.2.3)
Lus10003816 174 / 9e-53 AT3G22260 298 / 2e-103 Cysteine proteinases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G094700 357 / 5e-123 AT5G03330 316 / 9e-107 Cysteine proteinases superfamily protein (.1.2)
Potri.006G125900 343 / 3e-117 AT5G03330 329 / 1e-111 Cysteine proteinases superfamily protein (.1.2)
Potri.008G036700 258 / 9e-84 AT5G04250 372 / 2e-128 Cysteine proteinases superfamily protein (.1.2)
Potri.010G225400 257 / 3e-83 AT5G04250 360 / 2e-123 Cysteine proteinases superfamily protein (.1.2)
Potri.016G019700 232 / 2e-75 AT3G22260 333 / 5e-117 Cysteine proteinases superfamily protein (.1.2.3)
Potri.014G140200 223 / 8e-72 AT3G02070 358 / 2e-127 Cysteine proteinases superfamily protein (.1)
Potri.006G021700 218 / 3e-70 AT3G22260 347 / 2e-122 Cysteine proteinases superfamily protein (.1.2.3)
Potri.008G036900 215 / 1e-69 AT5G04250 239 / 4e-79 Cysteine proteinases superfamily protein (.1.2)
Potri.005G140500 67 / 3e-12 AT5G67170 401 / 3e-139 SEC-C motif-containing protein / OTU-like cysteine protease family protein (.1.2)
Potri.004G196800 51 / 6e-07 AT2G27350 458 / 3e-157 otubain-like deubiquitinase 1, OTU-like cysteine protease family protein (.1.2.3.4.5.6)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF02338 OTU OTU-like cysteine protease
Representative CDS sequence
>Lus10026525 pacid=23164326 polypeptide=Lus10026525 locus=Lus10026525.g ID=Lus10026525.BGIv1.0 annot-version=v1.0
ATGGCGGCGGCTCGCGATCATGATTCCGAATCGGATGTAATCCGGTGGGGGATGAGCCTTCTGGAAGTGGACCCACCCTTTTATCCCGGCTACTACGGCG
GCGAAACAATTCAAAACGACCATGCCTATCATCATCTTCCTCGCCATGACGATTGCGAAGCTGAAGATAACGACGAAATCATAGCTCGCACACTTCAGGG
GGATTTCTCCCAGCTCGCTCTCAGAGACTCTTCAAGGTATTCCCGTGAACAAGTAGCGGAAGACTTCTCCCGGCCGTCCTATTATGGCGACAGCGACTGG
CCTACTGCCTCGACGAGTAACGACTCGTTTAATCACGATCGTCGCAATGAGGATTCTGATGATACGGTGTCCTCTAGCTTGTGTTCAAGCCCTAGCTATG
AGGAGCGACGGAAATTGTATCCTTCCGAATTAGCGGGTGATTATCGATTGGATGGTGAAGTAGGCAAAAGGTTGAATCAGTTTATACCCATTCGTCATGT
TCCTAAGATGAATGGAGAAATACCTTCATTTGATGAAGTAGCATCAGACCATGAGAGGCTTCTGAATAGATTGGAGGCATTTGGTTTTGCTGAGATCAAG
GTTCAAGGAGATGGGAACTGTCAGTTTCGAGCATTATCAGATCAATTATACGGAACTCCTGATTGCCACAAAACTGTTAGAAAAGAGATTGTAAAACAGC
TAAAATCCAACCCTGAGATATATGAAGGATATGTTCCCATGAAGTATCGTGAATACTTGAGCAACATGTCCAGATCTGGTGAATGGGGTGACCACGTCAC
ATTGCAGGCAGCAGCTGATTCGTATGCTGTGAAAATACTCGTCATAACTTCATTCAAGGATACTTCCTCCATAGAGATTCTTCCACGAAAGAAGAAGCCA
CAGAGAGTCATCTTCTTGAGTTTCTGGGCGGAGGTACATTACAATGCAATCTGTTTCCGCAATAGAGACACAGCGGGCTCGGAACCTGATAAGAAGAAGA
AGAAACGAAGGTGGATATTTGGCAAGAAACACTGA
AA sequence
>Lus10026525 pacid=23164326 polypeptide=Lus10026525 locus=Lus10026525.g ID=Lus10026525.BGIv1.0 annot-version=v1.0
MAAARDHDSESDVIRWGMSLLEVDPPFYPGYYGGETIQNDHAYHHLPRHDDCEAEDNDEIIARTLQGDFSQLALRDSSRYSREQVAEDFSRPSYYGDSDW
PTASTSNDSFNHDRRNEDSDDTVSSSLCSSPSYEERRKLYPSELAGDYRLDGEVGKRLNQFIPIRHVPKMNGEIPSFDEVASDHERLLNRLEAFGFAEIK
VQGDGNCQFRALSDQLYGTPDCHKTVRKEIVKQLKSNPEIYEGYVPMKYREYLSNMSRSGEWGDHVTLQAAADSYAVKILVITSFKDTSSIEILPRKKKP
QRVIFLSFWAEVHYNAICFRNRDTAGSEPDKKKKKRRWIFGKKH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G03330 Cysteine proteinases superfami... Lus10026525 0 1
AT3G04970 DHHC-type zinc finger family p... Lus10018967 3.5 0.9490
AT1G02860 BAH1, NLA nitrogen limitation adaptation... Lus10030375 3.5 0.9467
AT3G22260 Cysteine proteinases superfami... Lus10003816 4.2 0.9452
AT4G16150 CAMTA calmodulin binding;transcripti... Lus10041126 5.7 0.9221
AT1G21000 PLATZ transcription factor fam... Lus10002700 6.2 0.9567
AT1G74100 SOT16, ATSOT16,... CORONATINE INDUCED-7, ARABIDOP... Lus10033718 8.3 0.9257
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Lus10029684 8.7 0.9458
AT3G04970 DHHC-type zinc finger family p... Lus10033823 10.4 0.9401
AT3G27020 YSL6 YELLOW STRIPE like 6 (.1) Lus10032024 11.4 0.9452
AT4G24740 AME1, AFC2 FUS3-complementing gene 2 (.1.... Lus10019458 13.0 0.9386

Lus10026525 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.