Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03345 112 / 6e-34 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013817 [exp] 127 / 2e-39 AT5G03345 164 / 5e-54 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G125300 [exp] 110 / 7e-33 AT5G03345 143 / 8e-46 unknown protein Potri.016G091900 [exp] 101 / 3e-29 AT5G03345 143 / 5e-46 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10270 [flax] [poplar] MMgT Membrane magnesium transporter
Representative CDS sequence Show only first row Show all	>Lus10026529 pacid=23164252 polypeptide=Lus10026529 locus=Lus10026529.g ID=Lus10026529.BGIv1.0 annot-version=v1.0 ATGGGTTTGGGTTTTACAGTCGGCGTAATTGGAGTTCTAGTTCTCGGCCACGCCGTCTATTCAACTATTCAATATAGGGGATTACTGAAGATTATGGAGG ATGAATTCTCGGGACCTCCAATGGATGTGGTGCTGGAGTTGCTCGTGGGATTATTATTATGTATGTGGGCAGCTTTAACTGTTCCAGGGAAGTTCCTTGC CATACATCCGCATTCTGATGAAAACAGGTATGCTCTCCTTCGTTTGATAATGGTTTCCCATCAGTTAGATTCTGTTTTAGCCAAGAACATGAGCTAG
AA sequence Show only first row Show all	>Lus10026529 pacid=23164252 polypeptide=Lus10026529 locus=Lus10026529.g ID=Lus10026529.BGIv1.0 annot-version=v1.0 MGLGFTVGVIGVLVLGHAVYSTIQYRGLLKIMEDEFSGPPMDVVLELLVGLLLCMWAALTVPGKFLAIHPHSDENRYALLRLIMVSHQLDSVLAKNMS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03345			unknown protein		Lus10026529 [exp]	0	1
AT5G03345			unknown protein		Lus10013817 [exp]	3.2	0.8917
AT4G28830			S-adenosyl-L-methionine-depend...		Lus10043228 [exp]	4.5	0.9012
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10023582 [exp]	4.6	0.8923
AT2G30280		RDM4, DMS4	DEFECTIVE IN MERISTEM SILENCIN...		Lus10035851 [exp]	6.5	0.8771
AT4G23885			unknown protein		Lus10001827 [exp]	10.5	0.8877
AT5G63440			Protein of unknown function (D...		Lus10016760 [exp]	10.6	0.8529
AT3G55620		eIF6A, EMB1624	embryo defective 1624, eukaryo...		Lus10037938 [exp]	12.2	0.8910
AT5G55630		ATTPK1, ATKCO1	TWO PORE K CHANNEL 1, TWO PORE...		Lus10001912 [exp]	12.2	0.8832
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10024423 [exp]	12.3	0.8814
AT2G18390		HAL, ARL2, TTN5...	TITAN 5, HALLIMASCH, ARF-LIKE ...		Lus10026383 [exp]	12.5	0.8921

Compare expression of checked genes

Lus10026529 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.