Lus10026531 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09870 88 / 3e-23 SAUR-like auxin-responsive protein family (.1)
AT2G28085 61 / 9e-13 SAUR-like auxin-responsive protein family (.1)
AT4G38860 52 / 2e-09 SAUR-like auxin-responsive protein family (.1)
AT5G20810 52 / 5e-09 SAUR-like auxin-responsive protein family (.1.2)
AT1G56150 51 / 5e-09 SAUR-like auxin-responsive protein family (.1)
AT1G20470 51 / 6e-09 SAUR-like auxin-responsive protein family (.1)
AT4G34770 50 / 1e-08 SAUR-like auxin-responsive protein family (.1)
AT5G10990 50 / 1e-08 SAUR-like auxin-responsive protein family (.1)
AT3G12830 50 / 2e-08 SAUR-like auxin-responsive protein family (.1)
AT1G19840 50 / 2e-08 SAUR-like auxin-responsive protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013819 239 / 9e-83 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1)
Lus10004014 187 / 2e-62 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1)
Lus10030263 179 / 4e-59 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1)
Lus10001398 122 / 3e-36 AT3G09870 97 / 9e-27 SAUR-like auxin-responsive protein family (.1)
Lus10023012 119 / 2e-35 AT3G09870 97 / 5e-27 SAUR-like auxin-responsive protein family (.1)
Lus10001397 79 / 1e-19 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1)
Lus10026532 73 / 1e-17 AT3G09870 64 / 3e-14 SAUR-like auxin-responsive protein family (.1)
Lus10021435 71 / 2e-16 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
Lus10016130 71 / 2e-16 AT2G28085 111 / 2e-32 SAUR-like auxin-responsive protein family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G092400 119 / 1e-35 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1)
Potri.006G125100 114 / 1e-33 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1)
Potri.010G226400 81 / 3e-20 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1)
Potri.015G006800 56 / 5e-11 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1)
Potri.005G237200 55 / 1e-10 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1)
Potri.002G024300 54 / 3e-10 AT1G75580 170 / 2e-56 SAUR-like auxin-responsive protein family (.1)
Potri.006G278100 55 / 4e-10 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1)
Potri.014G103300 53 / 9e-10 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1)
Potri.012G023400 53 / 1e-09 AT2G46690 125 / 4e-38 SAUR-like auxin-responsive protein family (.1)
Potri.004G164300 53 / 2e-09 AT5G10990 170 / 3e-55 SAUR-like auxin-responsive protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02519 Auxin_inducible Auxin responsive protein
Representative CDS sequence
>Lus10026531 pacid=23164362 polypeptide=Lus10026531 locus=Lus10026531.g ID=Lus10026531.BGIv1.0 annot-version=v1.0
ATGTTCAACAACAGCGATGACGAAAGCATCCGAGGGTTGATGCTGCTAAAGTTCTTCACAAGAATGCTGCAAAGGACACTGATGATGATGACATCCAGAT
CAGGAGGGCAGAAGCTGCAGAAAACCAGCACTACTGGAGAGTATGAAGAAGACAAAGAAGGGATGAAGGAAGTTCCAAACGATGTGAAGAGAGGACAGTT
TGCCGTGACAGCAACCAAAGGTGGGAAGCCAAAGAGGTTCATTGTCGAGTTGGATGACCTCAATGACCCTGATTTCCTCACCTTGCTCGAACTGTCTGAG
GAAAAATTCGGGTTTGGCCAGGCAGGTGTGCTTGAGGTCCCTTGTTACCCTCTGGAGCTTCAGAAGGTTCTACGAGGTGGCAAAATCAGAAGGGCAAGTG
CACAATGGTAG
AA sequence
>Lus10026531 pacid=23164362 polypeptide=Lus10026531 locus=Lus10026531.g ID=Lus10026531.BGIv1.0 annot-version=v1.0
MFNNSDDESIRGLMLLKFFTRMLQRTLMMMTSRSGGQKLQKTSTTGEYEEDKEGMKEVPNDVKRGQFAVTATKGGKPKRFIVELDDLNDPDFLTLLELSE
EKFGFGQAGVLEVPCYPLELQKVLRGGKIRRASAQW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09870 SAUR-like auxin-responsive pro... Lus10026531 0 1
AT3G45070 P-loop containing nucleoside t... Lus10041611 4.4 0.8438
AT4G12910 SCPL20 serine carboxypeptidase-like 2... Lus10009562 10.9 0.8382
AT1G68800 TCP TCP12, BRC2, TC... BRANCHED 2, TCP domain protein... Lus10035055 11.5 0.8123
AT3G47570 Leucine-rich repeat protein ki... Lus10030852 13.1 0.8349
AT5G54010 UDP-Glycosyltransferase superf... Lus10003154 17.7 0.7463
AT2G23945 Eukaryotic aspartyl protease f... Lus10002275 19.1 0.7538
AT5G57150 bHLH bHLH035 basic helix-loop-helix (bHLH) ... Lus10036068 25.5 0.8018
Lus10011890 25.9 0.8142
AT4G38840 SAUR-like auxin-responsive pro... Lus10038191 27.2 0.8035
AT2G37300 ABCI16 ATP-binding cassette I16, unkn... Lus10009075 30.2 0.8153

Lus10026531 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.