Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09870 63 / 5e-14 SAUR-like auxin-responsive protein family (.1) AT2G28085 60 / 1e-12 SAUR-like auxin-responsive protein family (.1) AT1G20470 56 / 9e-11 SAUR-like auxin-responsive protein family (.1) AT4G38860 53 / 4e-10 SAUR-like auxin-responsive protein family (.1) AT4G34750 54 / 5e-10 SAUR-like auxin-responsive protein family (.1.2) AT1G76190 53 / 7e-10 SAUR-like auxin-responsive protein family (.1) AT2G21220 51 / 2e-09 SAUR-like auxin-responsive protein family (.1) AT1G19830 51 / 4e-09 SAUR-like auxin-responsive protein family (.1) AT4G34800 50 / 7e-09 SAUR-like auxin-responsive protein family (.1) AT2G24400 51 / 9e-09 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001397 [exp] 136 / 1e-42 AT2G28085 69 / 8e-16 SAUR-like auxin-responsive protein family (.1) Lus10023011 [exp] 98 / 7e-28 AT3G09870 59 / 1e-12 SAUR-like auxin-responsive protein family (.1) Lus10004014 [exp] 76 / 8e-19 AT3G09870 101 / 1e-28 SAUR-like auxin-responsive protein family (.1) Lus10030263 [exp] 76 / 1e-18 AT3G09870 100 / 4e-28 SAUR-like auxin-responsive protein family (.1) Lus10026531 [exp] 74 / 9e-18 AT3G09870 89 / 7e-24 SAUR-like auxin-responsive protein family (.1) Lus10016129 [exp] 73 / 2e-17 AT2G28085 115 / 4e-34 SAUR-like auxin-responsive protein family (.1) Lus10013819 [exp] 72 / 3e-17 AT3G09870 92 / 7e-25 SAUR-like auxin-responsive protein family (.1) Lus10021436 [exp] 72 / 5e-17 AT2G28085 117 / 6e-35 SAUR-like auxin-responsive protein family (.1) Lus10021435 [exp] 71 / 1e-16 AT2G28085 108 / 4e-31 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G092400 [exp] 89 / 8e-24 AT3G09870 108 / 8e-32 SAUR-like auxin-responsive protein family (.1) Potri.006G125100 [exp] 84 / 4e-22 AT3G09870 103 / 2e-29 SAUR-like auxin-responsive protein family (.1) Potri.010G226400 [exp] 75 / 2e-18 AT2G28085 51 / 3e-09 SAUR-like auxin-responsive protein family (.1) Potri.009G141201 [exp] 57 / 3e-11 AT5G27780 132 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 57 / 6e-11 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 55 / 2e-10 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 55 / 3e-10 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.004G164400 [exp] 52 / 1e-09 AT4G34760 182 / 4e-61 SAUR-like auxin-responsive protein family (.1) Potri.005G237200 [exp] 52 / 1e-09 AT1G75580 164 / 5e-54 SAUR-like auxin-responsive protein family (.1) Potri.009G127300 [exp] 51 / 1e-09 AT2G21210 104 / 8e-31 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10026532 pacid=23164240 polypeptide=Lus10026532 locus=Lus10026532.g ID=Lus10026532.BGIv1.0 annot-version=v1.0 ATGATCCCCACAACTGGAGGTGGCTCGCTAGTGTTGAGGCAGATCATGAAGATCCTTCATCAGAGGTTTAACTTAAACTTTCCACCTTCCTACACCGGTT TCGGCGAAGATTTTGACGATCTGGATCCGTCATCCGAGGTGCTGCCGGCAGATGTGAAAGAGGGGCATTTCGTTGTCTATACTGCAAATGACGGTGAGCC TAAGAGGTGTCTTATAAGGCTGGATTACTTGGCTCATCCGGGTTTTATTCGGCTACTCGAGCTGGCAGAGGAAGAATTCGGACTGCGACAAGTCGGAGTC CTTGCTGTCCCTTGCAGGTCAGTTGAGCTCGAAGACATTCTTGGGAACTAG
AA sequence Show only first row Show all	>Lus10026532 pacid=23164240 polypeptide=Lus10026532 locus=Lus10026532.g ID=Lus10026532.BGIv1.0 annot-version=v1.0 MIPTTGGGSLVLRQIMKILHQRFNLNFPPSYTGFGEDFDDLDPSSEVLPADVKEGHFVVYTANDGEPKRCLIRLDYLAHPGFIRLLELAEEEFGLRQVGV LAVPCRSVELEDILGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09870			SAUR-like auxin-responsive pro...		Lus10026532 [exp]	0	1
					Lus10013985 [exp]	43.6	0.7846
AT5G49880			mitotic checkpoint family prot...		Lus10007438 [exp]	57.8	0.8036

Compare expression of checked genes

Lus10026532 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.