Lus10026536 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36870 365 / 4e-127 XTH32 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
AT3G44990 328 / 1e-112 AtXTH31, XTH31, ATXTR8, XTR8 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
AT1G32170 201 / 3e-62 XTH30, XTR4 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
AT1G10550 192 / 5e-59 XTH33, XET xyloglucan:xyloglucosyl transferase 33 (.1)
AT2G01850 192 / 8e-59 ATXTH27, EXGT-A3 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
AT4G18990 188 / 3e-57 XTH29, XTR13 xyloglucan endotransglucosylase/hydrolase 29 (.1)
AT1G14720 187 / 8e-57 ATXTH28, EXGT-A2, XTR2 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
AT3G25050 180 / 1e-54 XTH3 xyloglucan endotransglucosylase/hydrolase 3 (.1)
AT4G14130 174 / 1e-52 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 173 / 5e-52 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001396 386 / 2e-135 AT2G36870 460 / 8e-165 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10023009 385 / 5e-135 AT2G36870 466 / 3e-167 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013822 374 / 1e-130 AT2G36870 444 / 1e-158 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10026535 374 / 2e-130 AT2G36870 444 / 9e-159 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10013823 364 / 6e-128 AT2G36870 301 / 7e-104 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10041341 344 / 1e-118 AT2G36870 421 / 2e-149 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10037377 341 / 1e-117 AT2G36870 422 / 9e-150 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10016144 338 / 3e-116 AT2G36870 416 / 1e-147 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Lus10021422 337 / 4e-116 AT2G36870 417 / 4e-148 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G122900 376 / 1e-131 AT2G36870 478 / 4e-172 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.016G098600 365 / 4e-127 AT2G36870 477 / 1e-171 xyloglucan endotransglucosylase/hydrolase 32 (.1.2)
Potri.009G006600 334 / 4e-115 AT3G44990 407 / 3e-144 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 31, xyloglucan endo-transglycosylase-related 8 (.1)
Potri.001G136100 210 / 1e-65 AT1G32170 469 / 6e-167 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.003G097300 208 / 5e-65 AT1G32170 436 / 8e-154 xyloglucan endotransglycosylase 4, xyloglucan endotransglucosylase/hydrolase 30 (.1)
Potri.014G115000 190 / 2e-58 AT1G10550 367 / 9e-128 xyloglucan:xyloglucosyl transferase 33 (.1)
Potri.009G163850 189 / 2e-58 AT2G01850 319 / 6e-109 XYLOGLUCAN ENDOTRANSGLUCOSYLASE/HYDROLASE 27, endoxyloglucan transferase A3 (.1)
Potri.010G102300 188 / 2e-57 AT1G14720 470 / 7e-168 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.008G138400 186 / 1e-56 AT1G14720 467 / 2e-166 xyloglucan endotransglycosylase related 2, ENDOXYLOGLUCAN TRANSFERASE A2, xyloglucan endotransglucosylase/hydrolase 28 (.1)
Potri.011G077320 177 / 2e-53 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10026536 pacid=23164289 polypeptide=Lus10026536 locus=Lus10026536.g ID=Lus10026536.BGIv1.0 annot-version=v1.0
ATGGCTTCTTCTTCTTTGATGTTTTTCCTCGTAACACTTTCAATCCACTCAACAGCAAATTCCATCGCCAGCAAATACAATAAAAACCACCTAAAACTAG
AGCCACCGCATCCAGGCTACCGGCCGAGCACCAAGTTCAAGCCAACAACCTTTCATAACTGTTACAGAAACCTTTGGGGCCAGACCCATCAAAGGCTCAG
CCCGTACGGTCTAACCATGTGGCTCGATCGGATGTCAGGGAGCGGGTTCAAATCGTCCAAGTCGTATCGGTCTGGCTACTTTGGCGCTTCCATCAAGCTT
CAAGCTGGCTACACCGCCGGTGTCAACACGGCATTCTATCTGTCGAATAATGAGGCTCATCCAGGGAATCATGATGAGGTGGACATTGAATTTCTGGGGA
GGACACTGAAGGAGCCTTATACAGTGCAGACAAATGTGTACGTAAGAGGAAGTGGGGATGGAGGTGACATCATTGGGAGAGAAGCAAGGTTTCATTTGTG
GTTCGATCCCACCAAACACTTCCACCATTATGCCATTCTTTGGAATCCTAAAGAGATCATATTTTTAGTGGATGACATTCCAATAAGAAGGTACCAAAAG
AAAAGCGATGCAACATTCCCAACAAGATCAATGTGGGCTTACGGCTCGATATGGGATGCCTCGAATTGGGCCACGGACGACGGCAAATATAGAGCCGATT
ACAAATACCAACCTTTTGTTTCAAAGTACAGGACATTCGTGACATCCGGCTGCCCCAACGATGCTCCGCCGAGTTGCCCATCAGTATCGGCATCGCCTTA
TCGCTCCGGCGGGCTGACGGAACGGCAGATTACGGCAATGAGATGGGTGCAGAAACACCGAATGGTGTATCACTATTGCATGGACACAGCAAGGGACCAT
TCCCTCACCCCAGAGTGCAAGAAATTTGCGACAAAGATGCGTAAAAATAGTCCACCGATTGGATAG
AA sequence
>Lus10026536 pacid=23164289 polypeptide=Lus10026536 locus=Lus10026536.g ID=Lus10026536.BGIv1.0 annot-version=v1.0
MASSSLMFFLVTLSIHSTANSIASKYNKNHLKLEPPHPGYRPSTKFKPTTFHNCYRNLWGQTHQRLSPYGLTMWLDRMSGSGFKSSKSYRSGYFGASIKL
QAGYTAGVNTAFYLSNNEAHPGNHDEVDIEFLGRTLKEPYTVQTNVYVRGSGDGGDIIGREARFHLWFDPTKHFHHYAILWNPKEIIFLVDDIPIRRYQK
KSDATFPTRSMWAYGSIWDASNWATDDGKYRADYKYQPFVSKYRTFVTSGCPNDAPPSCPSVSASPYRSGGLTERQITAMRWVQKHRMVYHYCMDTARDH
SLTPECKKFATKMRKNSPPIG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36870 XTH32 xyloglucan endotransglucosylas... Lus10026536 0 1
Lus10025316 4.5 0.9660
Lus10034849 4.5 0.9469
AT5G53820 Late embryogenesis abundant pr... Lus10003056 4.7 0.9177
Lus10000325 6.3 0.9660
Lus10002099 7.7 0.9660
AT2G30880 Pleckstrin homology (PH) domai... Lus10027607 8.8 0.6541
AT2G46760 D-arabinono-1,4-lactone oxidas... Lus10004735 8.9 0.9660
AT1G17930 Aminotransferase-like, plant m... Lus10005495 10.0 0.9660
Lus10011594 11.0 0.9660
AT2G40780 Nucleic acid-binding, OB-fold-... Lus10030510 11.8 0.9660

Lus10026536 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.