Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03440 78 / 1e-20 unknown protein AT3G54880 75 / 2e-19 unknown protein AT5G25360 61 / 4e-13 unknown protein AT3G15770 60 / 9e-13 unknown protein AT1G15350 52 / 4e-10 unknown protein AT4G32342 50 / 4e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013824 [exp] 119 / 2e-36 AT3G54880 108 / 1e-31 unknown protein Lus10005466 [exp] 50 / 2e-09 AT5G25360 99 / 6e-28 unknown protein Lus10002164 [exp] 49 / 1e-08 AT5G25360 174 / 3e-56 unknown protein Lus10030101 [exp] 45 / 4e-08 AT5G25360 79 / 2e-20 unknown protein Lus10037957 [exp] 39 / 6e-05 AT3G54880 73 / 1e-17 unknown protein Lus10038690 [exp] 39 / 6e-05 AT3G54880 81 / 1e-20 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G034600 [exp] 80 / 4e-21 AT3G54880 120 / 8e-37 unknown protein Potri.010G227800 [exp] 79 / 1e-20 AT3G54880 123 / 7e-38 unknown protein Potri.018G027800 [exp] 69 / 3e-16 AT5G25360 182 / 1e-58 unknown protein Potri.006G254000 [exp] 67 / 1e-15 AT5G25360 197 / 3e-65 unknown protein Potri.001G192700 [exp] 64 / 2e-14 AT5G25360 169 / 1e-54 unknown protein Potri.006G068600 [exp] 56 / 3e-11 AT5G25360 194 / 9e-64 unknown protein Potri.018G130900 [exp] 56 / 4e-11 AT5G25360 140 / 8e-43 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026537 pacid=23164205 polypeptide=Lus10026537 locus=Lus10026537.g ID=Lus10026537.BGIv1.0 annot-version=v1.0 ATGATGGTTAACCGCAATAATGTAGCTGAGATTGCTTGGCATGAGACAAGGAAGCAGTGGGTTGGTGATTCCTCTCGGAGGTCAAAGCGAGCGCCTAGAG AAGAAATCATGAGTTTGTCATCGACATATGATGATTTGCTCTCTTCCCATGAACCTTTCCAGCAGCCAATACCTCTAGCTGAGATGGTGGACTTTTTAGT TGACATATGGCTCGAAGATGGCCTATACGACTGA
AA sequence Show only first row Show all	>Lus10026537 pacid=23164205 polypeptide=Lus10026537 locus=Lus10026537.g ID=Lus10026537.BGIv1.0 annot-version=v1.0 MMVNRNNVAEIAWHETRKQWVGDSSRRSKRAPREEIMSLSSTYDDLLSSHEPFQQPIPLAEMVDFLVDIWLEDGLYD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03440			unknown protein		Lus10026537 [exp]	0	1
AT5G56360		PSL4	PRIORITY IN SWEET LIFE 4, calm...		Lus10013398 [exp]	2.8	0.7834
AT1G26355		SP1L1	SPIRAL1-like1 (.1)		Lus10000046 [exp]	7.5	0.7609
AT2G45200		ATGOS12, GOS12	golgi snare 12 (.1.2)		Lus10001986 [exp]	7.7	0.7447
AT4G23330			unknown protein		Lus10032266 [exp]	8.9	0.7448
AT5G10550		GTE2	global transcription factor gr...		Lus10020471 [exp]	11.4	0.7551
AT1G06530		PMD2	peroxisomal and mitochondrial ...		Lus10031394 [exp]	29.6	0.7233
AT5G41020	MYB		myb family transcription facto...		Lus10024036 [exp]	31.9	0.7427
AT3G22550			Protein of unknown function (D...		Lus10006102 [exp]	36.3	0.7281
AT1G58170			Disease resistance-responsive ...		Lus10026176 [exp]	37.9	0.7394
AT4G32530			ATPase, F0/V0 complex, subunit...		Lus10000347 [exp]	39.8	0.6930

Compare expression of checked genes

Lus10026537 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.