Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G27770 105 / 7e-31 Ribosomal L22e protein family (.1) AT3G05560 104 / 1e-30 Ribosomal L22e protein family (.1.2.3) AT1G02830 92 / 1e-25 Ribosomal L22e protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006509 [exp] 117 / 1e-35 AT3G05560 196 / 3e-66 Ribosomal L22e protein family (.1.2.3) Lus10037498 [exp] 116 / 2e-35 AT3G05560 197 / 1e-66 Ribosomal L22e protein family (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G128800 [exp] 116 / 2e-35 AT3G05560 173 / 2e-57 Ribosomal L22e protein family (.1.2.3) Potri.002G204100 [exp] 115 / 8e-35 AT3G05560 172 / 8e-57 Ribosomal L22e protein family (.1.2.3) Potri.013G015300 [exp] 114 / 9e-35 AT3G05560 172 / 1e-56 Ribosomal L22e protein family (.1.2.3) Potri.005G024400 [exp] 111 / 2e-33 AT3G05560 174 / 9e-58 Ribosomal L22e protein family (.1.2.3) Potri.010G012700 [exp] 104 / 2e-30 AT3G05560 170 / 8e-56 Ribosomal L22e protein family (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01776 [flax] [poplar] Ribosomal_L22e Ribosomal L22e protein family
Representative CDS sequence Show only first row Show all	>Lus10026555 pacid=23164350 polypeptide=Lus10026555 locus=Lus10026555.g ID=Lus10026555.BGIv1.0 annot-version=v1.0 ATGGCTCGCGGCGTGGCGGCAGCAGCAGCTGGAACGAAGGGTGGAAAGAAGAAGGGAGTTTCCTTCGTGATCGATTGCGGGAAGCCCGTCGAAGATAAGA TTATGGACATCGCCTCTCTGGAGAAGTTCCTCCAGGAAAGGATCAAGGTCGGGGGCAAGGCCGGCGCTCTTGGCGACGTTGTCTCCATCTCCAGGGAGAA GAACAAGATCACTGTCACCTCCGACAGCAATTTCTCTAAGAGGTAA
AA sequence Show only first row Show all	>Lus10026555 pacid=23164350 polypeptide=Lus10026555 locus=Lus10026555.g ID=Lus10026555.BGIv1.0 annot-version=v1.0 MARGVAAAAAGTKGGKKKGVSFVIDCGKPVEDKIMDIASLEKFLQERIKVGGKAGALGDVVSISREKNKITVTSDSNFSKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G05560			Ribosomal L22e protein family ...		Lus10026555 [exp]	0	1
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	1.0	0.9122
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10030200 [exp]	1.4	0.8893
AT5G27700			Ribosomal protein S21e (.1)		Lus10020645 [exp]	4.9	0.8325
AT4G02450			HSP20-like chaperones superfam...		Lus10026136 [exp]	7.2	0.7826
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	8.1	0.8137
AT4G15770			RNA binding (.1)		Lus10000507 [exp]	8.4	0.8057
AT2G31610			Ribosomal protein S3 family pr...		Lus10033442 [exp]	9.2	0.8223
AT1G71730			unknown protein		Lus10042772 [exp]	10.0	0.7602
AT4G17520			Hyaluronan / mRNA binding fami...		Lus10000599 [exp]	12.0	0.7604
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	12.0	0.7917

Compare expression of checked genes

Lus10026555 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.