Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G62830 119 / 2e-33 ATUXS2, UXS2, AUD1 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) AT2G47650 115 / 3e-32 UXS4 UDP-xylose synthase 4 (.1.2) AT3G53520 105 / 2e-28 ATUXS1, UXS1 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) AT2G28760 82 / 3e-20 UXS6 UDP-XYL synthase 6 (.1.2.3) AT3G46440 82 / 5e-20 UXS5 UDP-XYL synthase 5 (.1.2) AT5G59290 81 / 2e-19 ATUXS3, UXS3 UDP-glucuronic acid decarboxylase 3 (.1.2) AT2G28755 40 / 4e-06 UDP-D-glucuronate carboxy-lyase-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007875 [exp] 119 / 2e-35 AT3G62830 352 / 4e-122 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10003605 [exp] 123 / 9e-35 AT2G47650 693 / 0.0 UDP-xylose synthase 4 (.1.2) Lus10030368 [exp] 117 / 1e-32 AT3G62830 723 / 0.0 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10037499 [exp] 112 / 7e-31 AT3G62830 551 / 0.0 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10006510 [exp] 111 / 9e-31 AT3G62830 637 / 0.0 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10015038 [exp] 109 / 8e-30 AT3G53520 720 / 0.0 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) Lus10024436 [exp] 102 / 2e-27 AT3G53520 736 / 0.0 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) Lus10025293 [exp] 102 / 2e-27 AT3G53520 715 / 0.0 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) Lus10004951 [exp] 84 / 8e-23 AT3G46440 150 / 5e-46 UDP-XYL synthase 5 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G204400 [exp] 120 / 7e-34 AT3G62830 723 / 0.0 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.014G129200 [exp] 119 / 1e-33 AT3G62830 720 / 0.0 UDP-GLUCURONIC ACID DECARBOXYLASE 2, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.006G214000 [exp] 111 / 2e-30 AT3G53520 709 / 0.0 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) Potri.016G080500 [exp] 108 / 1e-29 AT3G53520 736 / 0.0 UDP-glucuronic acid decarboxylase 1 (.1.2.3.4) Potri.008G053100 [exp] 81 / 1e-19 AT2G28760 623 / 0.0 UDP-XYL synthase 6 (.1.2.3) Potri.001G237200 [exp] 81 / 2e-19 AT3G46440 637 / 0.0 UDP-XYL synthase 5 (.1.2) Potri.010G207200 [exp] 81 / 2e-19 AT2G28760 625 / 0.0 UDP-XYL synthase 6 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026557 pacid=23164334 polypeptide=Lus10026557 locus=Lus10026557.g ID=Lus10026557.BGIv1.0 annot-version=v1.0 ATGCCGTACAGAGCTAAGCAACAGGTTGGACCTTTCAATCTTGGGACTGCTGGACGATTTACAACGCTTTGTCTTGCTCAGGTGGTCCAGGAAACAATCG ACCCAAATGCAAATATTCAGTTGAGGCCAAACACTGAAGATGATCCACACAAGAGGAAGCCTGAGATCACCAAGGCCGAAGATCTGCTCAATTGGCAACC CAAAATCTCCCTCCGTAAGGGTTTTTTGCTTATGGCCTATGGCTTCGGATCTCGGCGTTGTTAA
AA sequence Show only first row Show all	>Lus10026557 pacid=23164334 polypeptide=Lus10026557 locus=Lus10026557.g ID=Lus10026557.BGIv1.0 annot-version=v1.0 MPYRAKQQVGPFNLGTAGRFTTLCLAQVVQETIDPNANIQLRPNTEDDPHKRKPEITKAEDLLNWQPKISLRKGFLLMAYGFGSRRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G62830		ATUXS2, UXS2, A...	UDP-GLUCURONIC ACID DECARBOXYL...		Lus10026557 [exp]	0	1
AT1G77610			EamA-like transporter family p...		Lus10018189 [exp]	2.0	0.7585
AT5G58003		CPL4	C-terminal domain phosphatase-...		Lus10037233 [exp]	12.2	0.6584
AT5G42520	BBR_BPC	BPC6, BBR/BPC6,...	ARABIDOPSIS THALIANA BASIC PEN...		Lus10012389 [exp]	18.4	0.6315
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Lus10038454 [exp]	20.6	0.6186
AT5G51020		CAA33, CRL	constitutive activator of AAA-...		Lus10016734 [exp]	26.5	0.6236
AT5G09250		KIWI	ssDNA-binding transcriptional ...		Lus10039207 [exp]	31.2	0.6341
AT3G52270			Transcription initiation facto...		Lus10040384 [exp]	38.7	0.6100
AT4G10180		FUS2, DET1, ATD...	FUSCA 2, DE-ETIOLATED 1, light...		Lus10042983 [exp]	44.7	0.6216
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Lus10018962 [exp]	70.8	0.6053
AT3G12810		CHR13, SRCAP, P...	PHOTOPERIOD-INDEPENDENT EARLY ...		Lus10007172 [exp]	101.8	0.5809

Compare expression of checked genes

Lus10026557 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.