Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38225 59 / 5e-12 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013843 [exp] 154 / 8e-47 AT4G38225 312 / 2e-103 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G207400 [exp] 73 / 1e-16 AT4G38225 397 / 8e-138 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026560 pacid=23164268 polypeptide=Lus10026560 locus=Lus10026560.g ID=Lus10026560.BGIv1.0 annot-version=v1.0 ATGCAGGTATCTGTCCAGCAGCTTAATGATGGCGGCAGCAGCTTGGAGAGTGAATGCTTGGTTAGAGATGAGATCGGGCTGGTGCTGCTGCCAAAAGAAA TGTGGTGTTCAGTGAAAGATAGTTCGTGCGAGGTTGGATGGATGTTTGACGATGGAAAAGCTGTTACTTTCACTTCCATCTTTGCTCCTGACGCCAAGCT TAAGGAAGTACGGATAGCACAGGAAACTACAGATCTAAAGGGGTGA
AA sequence Show only first row Show all	>Lus10026560 pacid=23164268 polypeptide=Lus10026560 locus=Lus10026560.g ID=Lus10026560.BGIv1.0 annot-version=v1.0 MQVSVQQLNDGGSSLESECLVRDEIGLVLLPKEMWCSVKDSSCEVGWMFDDGKAVTFTSIFAPDAKLKEVRIAQETTDLKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38225			unknown protein		Lus10026560 [exp]	0	1
AT3G06483		ATPDHK, PDK	pyruvate dehydrogenase kinase ...		Lus10018337 [exp]	1.7	0.9317
AT1G71480			Nuclear transport factor 2 (NT...		Lus10041048 [exp]	4.0	0.9121
AT5G57040			Lactoylglutathione lyase / gly...		Lus10017158 [exp]	6.2	0.9232
AT5G16720			Protein of unknown function, D...		Lus10010755 [exp]	6.2	0.9034
AT3G09050			unknown protein		Lus10035515 [exp]	6.6	0.9236
AT5G05200			Protein kinase superfamily pro...		Lus10012864 [exp]	9.2	0.9087
AT1G65230			Uncharacterized conserved prot...		Lus10027002 [exp]	9.2	0.9102
AT2G01110		TATC, PGA2, APG...	unfertilized embryo sac 3, TWI...		Lus10013482 [exp]	9.5	0.8997
AT5G49320			Protein of unknown function (D...		Lus10037723 [exp]	9.6	0.8898
AT5G20935			unknown protein		Lus10013382 [exp]	10.5	0.9053

Compare expression of checked genes

Lus10026560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.