Lus10026571 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G38160 252 / 6e-83 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
AT1G78930 117 / 1e-29 Mitochondrial transcription termination factor family protein (.1)
AT4G14605 94 / 1e-21 Mitochondrial transcription termination factor family protein (.1)
AT3G18870 89 / 8e-21 Mitochondrial transcription termination factor family protein (.1)
AT5G55580 85 / 2e-18 Mitochondrial transcription termination factor family protein (.1)
AT2G44020 84 / 4e-18 Mitochondrial transcription termination factor family protein (.1)
AT2G21710 83 / 1e-17 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
AT4G02990 81 / 3e-17 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
AT2G36000 76 / 7e-16 EMB3114 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
AT5G54180 66 / 6e-12 PTAC15 plastid transcriptionally active 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013854 397 / 3e-140 AT4G38160 446 / 2e-158 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Lus10035714 110 / 4e-27 AT1G78930 582 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10035227 99 / 3e-23 AT4G14605 518 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10032061 97 / 1e-22 AT4G14605 521 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10004614 95 / 7e-22 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Lus10042322 94 / 2e-21 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Lus10014877 93 / 4e-21 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Lus10004534 90 / 1e-20 AT2G44020 477 / 7e-168 Mitochondrial transcription termination factor family protein (.1)
Lus10003775 90 / 3e-20 AT5G55580 546 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G209400 320 / 1e-109 AT4G38160 481 / 3e-172 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.009G170300 312 / 5e-105 AT4G38160 479 / 8e-170 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3)
Potri.007G001800 129 / 8e-34 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.017G067600 94 / 1e-21 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.001G361800 93 / 2e-21 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.009G116200 93 / 3e-21 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1)
Potri.014G137400 87 / 2e-19 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1)
Potri.004G150600 85 / 3e-19 AT3G18870 311 / 1e-106 Mitochondrial transcription termination factor family protein (.1)
Potri.013G116700 86 / 7e-19 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1)
Potri.016G072200 77 / 4e-16 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10026571 pacid=23164211 polypeptide=Lus10026571 locus=Lus10026571.g ID=Lus10026571.BGIv1.0 annot-version=v1.0
ATGAAGAAAGAAAACGCTTTCGTTTCTGAGTCTTGCAGGGATATGGAAATGGCGTGCAATCAAAACCCTACCAGCGTGATGTGGTTCTTCAGGGACAGAG
GCTTCGACGAGAAAAGCATCAACGACATGTTCACAAAGTGCAAGCGTCTTGAAGGTGCTCACAAGGATAGAGCGTCAGAGAATTGGGATTTCCTGAAAAG
CATTGGCATCCAAGAAAGGAAGCTCCCTTCCATAATCTCCAAGCTGGTTAGCTACAGCATTGATACCAAGATGAAAGAGCTTGTTGACTTCCTTGTTGGT
TTGGGGCTTACCAGAGATGGGATGATTGGTAGAGTTCTTGTGAAGCACCCTTTCATAATGGGGTACAACATCGAGAAAAGGCTGCGGCCAACCTGCGAGT
TCTTAAGATCGGTTGGCCTCTCGGCTTCCGATCTTCAGACTGTTGTTTTGAAGTTCCCCGAGGTTGTGTGTAGAGATGTGGAGAAGACTTTGAAACCGAA
TTTTGCTTATCTGAGGGGATGTGGGTTTGGGGATGGACAGTTGGTTGCTTTGGTGACCGGTTACCCTCCCATTCTGATCAAGAGCATCCAGAACTCGTTA
GAACCTAGGATGAAGTTCTTGGTTGATGTTATGGGGAGACATCTTGATGAAGTTGTGGAGTACCCTAACTTCTTCCAGTGCGGGTTGAAGAAGACGCTCG
AGTCGAGGCACAGATTTTTGAGGCAGAGGAATGTAGAATGTAGCTTGAGCGATATGTTGAGCTGTAATCGTAAGAAGTTCTTCATGAAATATGGGTCCGG
TTGA
AA sequence
>Lus10026571 pacid=23164211 polypeptide=Lus10026571 locus=Lus10026571.g ID=Lus10026571.BGIv1.0 annot-version=v1.0
MKKENAFVSESCRDMEMACNQNPTSVMWFFRDRGFDEKSINDMFTKCKRLEGAHKDRASENWDFLKSIGIQERKLPSIISKLVSYSIDTKMKELVDFLVG
LGLTRDGMIGRVLVKHPFIMGYNIEKRLRPTCEFLRSVGLSASDLQTVVLKFPEVVCRDVEKTLKPNFAYLRGCGFGDGQLVALVTGYPPILIKSIQNSL
EPRMKFLVDVMGRHLDEVVEYPNFFQCGLKKTLESRHRFLRQRNVECSLSDMLSCNRKKFFMKYGSG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10026571 0 1
AT1G78630 EMB1473 embryo defective 1473, Ribosom... Lus10005553 3.6 0.9665
AT1G04940 AtTic20-I, atTI... translocon at the inner envelo... Lus10010636 4.5 0.9441
AT5G54600 Translation protein SH3-like f... Lus10038125 4.6 0.9656
AT1G48350 EMB3105 EMBRYO DEFECTIVE 3105, Ribosom... Lus10039092 5.3 0.9662
AT1G16790 ribosomal protein-related (.1) Lus10033346 5.6 0.9330
AT4G24220 5[beta]-StR, 5[... VEIN PATTERNING 1, Δ4,5-s... Lus10039687 6.8 0.9262
AT5G66470 RNA binding;GTP binding (.1) Lus10014289 6.9 0.9634
AT4G09040 RNA-binding (RRM/RBD/RNP motif... Lus10036468 7.5 0.9555
AT4G38160 PDE191 pigment defective 191, Mitocho... Lus10013854 9.2 0.9592
AT1G09900 Pentatricopeptide repeat (PPR-... Lus10015110 9.9 0.9526

Lus10026571 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.