Lus10026579 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G15220 225 / 2e-74 Plant basic secretory protein (BSP) family protein (.1)
AT2G15130 207 / 2e-67 Plant basic secretory protein (BSP) family protein (.1), Plant basic secretory protein (BSP) family protein (.2)
AT2G15170 58 / 6e-11 Plant basic secretory protein (BSP) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013863 447 / 1e-161 AT2G15220 224 / 9e-74 Plant basic secretory protein (BSP) family protein (.1)
Lus10019806 224 / 8e-74 AT2G15220 279 / 8e-96 Plant basic secretory protein (BSP) family protein (.1)
Lus10019807 206 / 9e-67 AT2G15220 229 / 5e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10019799 206 / 2e-66 AT2G15220 199 / 2e-64 Plant basic secretory protein (BSP) family protein (.1)
Lus10014106 204 / 7e-66 AT2G15220 230 / 2e-76 Plant basic secretory protein (BSP) family protein (.1)
Lus10019803 202 / 2e-65 AT2G15220 231 / 4e-77 Plant basic secretory protein (BSP) family protein (.1)
Lus10014111 199 / 8e-64 AT2G15220 202 / 3e-65 Plant basic secretory protein (BSP) family protein (.1)
Lus10019805 194 / 5e-62 AT2G15220 213 / 8e-70 Plant basic secretory protein (BSP) family protein (.1)
Lus10026582 192 / 7e-61 AT2G15220 206 / 1e-66 Plant basic secretory protein (BSP) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G299500 241 / 1e-80 AT2G15220 298 / 1e-103 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094600 232 / 4e-77 AT2G15220 288 / 3e-99 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299400 231 / 1e-76 AT2G15220 280 / 2e-96 Plant basic secretory protein (BSP) family protein (.1)
Potri.001G299600 221 / 9e-73 AT2G15220 277 / 6e-95 Plant basic secretory protein (BSP) family protein (.1)
Potri.009G094500 202 / 4e-65 AT2G15220 269 / 8e-92 Plant basic secretory protein (BSP) family protein (.1)
Potri.005G202300 53 / 4e-08 AT2G42900 134 / 2e-37 Plant basic secretory protein (BSP) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0126 Peptidase_MA PF04450 BSP Peptidase of plants and bacteria
Representative CDS sequence
>Lus10026579 pacid=23164344 polypeptide=Lus10026579 locus=Lus10026579.g ID=Lus10026579.BGIv1.0 annot-version=v1.0
ATGTCTTCACGCATTCTCCTCCTCCTCCTAGTCCTCGCATCGGCGGCTTTCTTCCACGGCTGCCGATGCGACAGCGACATCGACTACGTAGTAGTCAACA
ACTCCCCCGACGCACCGGGGGGAGGCAGGTTCATGGACGAGATCGGAGTTGACTACGCAAGGTCGAAAATGTCATCAGCCACGGACTTCATCTTCGACAT
CTTCCAACAACGCAACAACACGTCGGAGAGAAGAGGGTACAAACAAGTGAAGCTATTCATCAACAAGTTCAACGCCGCCCAGGTGGCCTACACGGGCGAG
AACGAAGTCTACTTCAGCGCGGACTTCATTGGGAACTACGCGGGCGGGGACCTGAAGAAGGAGTTCACCGGGGTGCTGTACAGGGAGATGGCGCACGTGT
GGCAGTGGAACGGCGGCGGGAAGGCGCCGGCTGGAGTAGTGGAAGGGATCGCAGCTTACGTCAGGGTGAAGGCTGACCTGGCGCCTGATTATTGGGTGAA
GCCTGGTGGTGGGGACAGGTGGGACCAAGGGTACGATGTTGCCGGGAGGTTTGTGGAGTACTGCGAGGGAGTTAGAAAAGGGTTTGTGGCGGAGATGAAT
AGGAAGATGAAGGATGGCTATAGTGAAGGGTATTTTGGTCAGGTGATGGGTGGGAAGAGTGTTGGGCAGGTTTGGAGTGAGTATAAGAAGAAGTATACCA
AAGTTCACAGGGGAAGAAAGTACTGA
AA sequence
>Lus10026579 pacid=23164344 polypeptide=Lus10026579 locus=Lus10026579.g ID=Lus10026579.BGIv1.0 annot-version=v1.0
MSSRILLLLLVLASAAFFHGCRCDSDIDYVVVNNSPDAPGGGRFMDEIGVDYARSKMSSATDFIFDIFQQRNNTSERRGYKQVKLFINKFNAAQVAYTGE
NEVYFSADFIGNYAGGDLKKEFTGVLYREMAHVWQWNGGGKAPAGVVEGIAAYVRVKADLAPDYWVKPGGGDRWDQGYDVAGRFVEYCEGVRKGFVAEMN
RKMKDGYSEGYFGQVMGGKSVGQVWSEYKKKYTKVHRGRKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G15220 Plant basic secretory protein ... Lus10026579 0 1
AT1G66230 MYB ATMYB20 myb domain protein 20 (.1) Lus10004042 2.2 1.0000
Lus10011962 3.2 1.0000
AT2G20340 Pyridoxal phosphate (PLP)-depe... Lus10012601 3.9 1.0000
AT1G53830 ATPME2 pectin methylesterase 2 (.1) Lus10027556 4.5 0.9937
Lus10022805 4.5 1.0000
AT5G05530 RING/U-box superfamily protein... Lus10024629 5.0 1.0000
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10014637 6.0 1.0000
AT5G04350 Plant self-incompatibility pro... Lus10029388 6.5 1.0000
Lus10030558 6.9 1.0000
AT5G24550 BGLU32 beta glucosidase 32 (.1) Lus10030911 7.3 1.0000

Lus10026579 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.